Small Animal Model ACE2 & Antibody Response Comparison

From OpenWetWare
Jump to navigationJump to search

Our Research Question

How similar are the ACE2 receptors for SARS-CoV-2 within small-animal models compared to humans with reference to neutralizing antibody activity?

Publicly Available Data We Will Need to Gather to Answer Our Question

Analysis Tools We Will Use to Answer Our Question with the Data

Anna

  • Navigated to GenBank in order to find the nineteen sequences.
  • Sequences used included:
>NP_001358344.1 angiotensin-converting enzyme 2 isoform 1 precursor [Homo sapiens]
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWS
AFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQE
CLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVN
GVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYS
LTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWD
LGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEP
VPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRL
GKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGD
KAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEV
EKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKK
KNKARSGENPYASIDISKGENNPGFQNTDDVQTSF
>XP_005074266.1 angiotensin-converting enzyme 2 [Mesocricetus auratus]
MSSSSWLLLSLVAVTTAQSIIEEQAKTFLDKFNQEAEDLSYQSALASWNYNTNITEENAQKMNEAAAKWS
AFYEEQSKLAKNYSLQEVQNLTIKRQLQALQQSGSSALSADKNKQLNTILNTMSTIYSTGKVCNPKNPQE
CLLLEPGLDDIMATSTDYNERLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYEDYGDYWRGDYEAE
GADGYNYNGNQLIEDVERTFKEIKPLYEQLHAYVRTKLMNTYPSYISPTGCLPAHLLGDMWGRFWTNLYP
LTVPFGQKPNIDVTDAMVNQGWNAERIFKEAEKFFVSVGLPYMTQGFWENSMLTDPGDDRKVVCHPTAWD
LGKGDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSAATPEHLKS
IGLLPSDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGDIPKEQWMEKWWEMKREIVGVVEP
LPHDETYCDPAALFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKHDGPLHKCDISNSTEAGQKLLNMLRL
GKSEPWTLALENVVGARNMDVRPLLNYFEPLSVWLKEQNKNSFVGWNTDWSPYADQSIKVRISLKSALGE
NAYEWDDNEMYLFRASVAYAMRVYFAKNKTQTVPFGVEDIRVSDLKPRVSFNFFVTSPQNVSDIIPRNEV
EEAVRLSRGRINDVFGLDDNSLEFLGINPTLSPPYQPPVTIWLIIFGVVMGIVVVGIIILIFTGIKGRKK
KNETKREENPYDSVDIGKGESNAGFLSNDDAQTSF
>XP_027288607.1 angiotensin-converting enzyme 2 [Cricetulus griseus]
MSSSSWLLLSLVAVTTAQSIIEEQAKTFLDKFNQEAEDLSYQSALASWNYNTNITEENAQKMNEAAAKWS
AFYEEQSKLAKNYSLQEVQNLIIKRQLQALQQSGSSALSADKNKQLNTILNTMSTIYSTGKVCNPKNPQE
CLLLEPGLDDIMATSTDYNERLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYKDYGDYWRGDYEAE
GADGYNYNGNQLIEDVERTFKEIKPLYEQLHAYVRTKLMDTYPSFISPTGCLPAHLLGDMWGRFWTNLYP
LTVPFGQKPNIDVTDAMVNQGWDAERIFKEAEKFFVSVGLPHMTQGFWGNSMLTDPGDDRKVVCHPTAWD
LGKGDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLPSNFHEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGDIPKEKWMEKWWEMKREIVGVVEP
LPHDETYCDPAALFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKHDGPLHKCDISNSTEAGQKLLNMLRL
GKSEPWTLALENVVGARNMDVRPLLNYFEPLSVWLKEQNKNSFVGWNTDWSPYADQSIKVRISLKSALGE
NAYEWNDNEMYLFRATVAYAMRVYFAKNKTQTVLFGVEDIRVSDLKPRVSFNFFVTSPQNVSDIIPRNEV
EEAVRFSRGRINDVFGLDDNSLEFLGINPTLAPPYQPPVTIWLIIFGVVMGIVVVGIVILIVTGIRARKK
NNEAKREENPYDSVDIGKGESNAGFQSNDDVQTSF
>XP_028743609.1 angiotensin-converting enzyme 2 [Peromyscus leucopus]
MSSSSWLLLSLVAVTTAQSIIEEQAKIFLDKFNQEAEDLSYQSALASWNYNTNITEENAQKMNEASAKWS
AFYEEQSKLAKNYSLQEIPNLIIKRQLQALQQSGSSALSADKTKQLNTILNAMSTIYSTGKVCKPKNPQE
CLLLEPGLDVIMATSTDYNERLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYRDYGDYWRGDYEAE
GAEGYNYNRNQLIEDVERIFQEIKPLYEHLHAYVRTKLMDTYPSYINPTGCLPAHLLGDMWGRFWTNLYP
LTVPFGQKPNIDVTDAMLKQGWDAERIFKEAEKFFVSIGLPPMTQGFWENSMLVDPGDDRKVVCHPTAWD
LGKGDFRIKMCTTVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSAATPEHLKS
IGLLPSDFREDSETEINFLLKQALTIVGTLPFTYMLEKWRWMVFTGEIPKEQWMQKWWEMKREIVGVVEP
LPHDETYCDPAALFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKHDGPLHKCDISNSTEAGQKLLNMLRL
GNSEPWTLALENVVGARNMDVRPLLNYFEPLFAWLKEQNKNSLVGWNTDWSPYADQSIKVRISLKSALGK
NAYEWNDNEMYLFRSSVAYAMRVYFAMNKTQNVPFGVEDIHVSDLKPRVSFNFFVTSPQNVSDIIPRKDV
EDAIRFSRGRINDVFGLDDNSLEFLGIYPTLAPPYQPPVTIWLIIFGIVMGIVVVGIVILIFTGIKGRKK
KNETKREENPYDSMDIGKGESNAGFQNNDDAQTSF
>XP_036030683.1 angiotensin-converting enzyme 2 [Onychomys torridus]
MSSSSWLLLSLVAVTTAQSIIEEQAKTFLDKFNQEAEDLSYQSALASWNYNTNITEENAQKMNEAAAKWS
AFYEEQSKLAKNYSLQEIQNLIIKRQLQALQQSGSSALSADKNKQLNTILNAMSTIYSTGKVCKPKNPQE
CLLLEPGLDVIMATSTDYNERLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYKDYGDYWRGGYEAE
GAEGYNYNRNQLIEDVERTFQEIKPLYEQLHAYVRTKLMDTYPSYINPTGCLPAHLLGDMWGRFWTNLYS
LTVPFGQKPNIDVTDAMMKQGWDAERIFKEAEKFFVSVGLPHMTQGFWENSMLVDPGDDRKVVCHPTAWD
LGKGDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSAATPEHLKS
IGLLPSDFHEDSETEINFLLKQALTIVGTLPFTYMLEKWRWMVFTGEIPKEQWMQKWWEMKREIVGVVEP
LPHDETYCDPAALFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKYDGPLHKCDISNSTEAGQKLLNMLRL
GNSEPWTLALENVVGARNMDVRPLLNYFEPLFAWLKEQNKNSLVGWNTDWSPYADQSIKVRISLKSALGK
NAYEWNDNEMYLFRSSVAYAMRVYFAKNKTQIVPFGVEDIHVSDLKPRVSFNFFVTSPQNVSDIIPRKEV
EDAIRFSRGRINDVFGLDDNSLEFLGIYPTLAPPYQPPVTIWLIIFGVVMGIVVVGIVILIFTGIKGRKK
KNETKREENPYDSMDIGKGESNAGFQNNDDVQTSF
>XP_032746145.1 angiotensin-converting enzyme 2 [Rattus rattus]
MSRSPWLLLSLVAVATAQSLIEEKAESFLNKFNQEAEDLSYQSSLASWNYNTNITEENAQKMNEAAAKWS
AFYEEQSKIAQNFSLQEIQDATIKRQLKALQQSGSSALSPDKNKQLNTILNTMSTIYSTGKVCNSMNPQE
CFVLEPGLDEIMATSTDYNRRLWAWEGWRAEVGKQLRPLYEEYVVLKNEMARANNYEDYGDYWRGDYEAE
GVEGYNYNRNQLIEDVENTFKEIKPLYEQLHAYVRTKLMDVYPSYISPTGCLPAHLLGDMWGRFWTNLYP
LTTPFLQKPNIDVTDAMVNQSWDAERIFKEAEKFFVSVGLPQMTPGFWTNSMLTEPGDDRKVVCHPTAWD
LGHGDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYAKQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLPSNFQEDDETEINFLLKQALIIVGTLPFTYMLEKWRWMVFQDKIPREQWTQKWWEMKREIVGVVEP
LPHDETYCDPASLFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKHDGPLHKCDISNSTEAGQKLLNMLSL
GNSGPWTLALENVVGSRNMDVKPLLNYFQPLFVWLKEQNSNSTVGWNTDWSPCDFTDCTHYEWTDNEMYL
FRSSVAYAMREYFSREKNQTVPFGEADVWVSDLKPRVSFNFFVTSPKNVSDIIPRSEVEEAIRMSRGRIN
DIFGLNDNSLEFLGIYPTLKPPYEPPVTIWLIIFGVVMGMVVVGIVILIVTGIKGRKKKNETKREENPYD
SVDIGKGESNAGFQNSDDAQTSF
>XP_023417808.1 LOW QUALITY PROTEIN: angiotensin-converting enzyme 2 [Cavia porcellus]
MRSGGRGKMSGSFWFLLNLVAVTTAQFNLEEQAKTFLDEFNLKAEDLYYQSSLASWNYNTNITDENVQKM
SEAGGILSAFYEEQSNLAKAYPLQDIQNLTVKRQLRILQQSGSSGFSADKNKQLSTILNTMSTLYSTGKV
CYPSDPQECLLLEPGLADIMSKSTDYNLRLWAWEGWRSKVGKQLRPLYEEYVALKNEMARANKYEDYGDY
WRRDYEVEDMDGYNYSRNQLIEDVERTFAEIKPLYEQLHAYVRTKLMETYPSRISPVGCLPAHLLGDMWG
RFWTELYSLTVPFQQKPNIDVTDAMESQSWDAEKIFKEAEKFFVSVGLPPMTQGFWKNSMLTEPGDGQKV
VCHPTAWDMGKNDFRIKMCTKVTMDHFLTAHHEMGHIQYDMAYAIQPFLLRDGANEGFHEAIGEIMSLSA
ATPEHLKSIGLLPPDFHEDNGTKXNSSLKQALTLLGTLPFTFMLEKGEGMVFTGENPQEQWIEKXWQMKR
EIVGVVEPLPHDETYCDPASLFHVSNDYSFIRYYTRTIYQFQFQEALCKAANHVGPLHKCDISNSTEAGQ
KLLNMLKLGKSEPWTLALESIVGTKNMDVKPLLNYFQPLSTWLQDQNRNSFVGWNTEWSPYSEESIKVRI
SLKSALGEDAYKWDDNEMYLFRSSVAYAMRKYFLDVKNQTVLFSWEDVRVSDWTHRVSFTFFVTEPNNVS
NIIPKTEVEDAIRLSRSRINDVFRLGXXHSGVSGIYPTLSPPYEPPVTIWLIVFGVVMGLVVVGIVVLVI
TGIRDRRKKKQKQREENPYSSVDIGKGENNTAFQNSEDNQTSF
>ACI04574.1 angiotensin converting enzyme 2 [Macaca mulatta]
MSGSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGEKWS
AFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPNNPQE
CLLLDPGLNEIMEKSLDYNERLWAWEGWRSEVGKQLRPLYEEYVVLKNEMARANHYKDYGDYWRGDYEVN
GVDGYDYNRDQLIEDVERTFEEIKPLYEHLHAYVRAKLMNAYPSYISPTGCLPAHLLGDMWGRFWTNLYS
LTVPFGQKPNIDVTDAMVNQAWNAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKVVCHPTAWD
LGKGDFRIIMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEP
VPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLLNMLKL
GKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGD
KAYEWNDNEMYLFRSSVAYAMRTYFLEIKHQTILFGEEDVRVADLKPRISFNFYVTAPKNVSDIIPRTEV
EEAIRISRSRINDAFRLNDNSLEFLGIQTTLAPPYQSPVTTWLIVFGVVMGVIVAGIVVLIFTGIRDRKK
KNQARSEENPYASIDINKGENNPGFQNTDDVQTSF
>QHX39726.1 angiotensin I converting enzyme 2 [Oryctolagus cuniculus]
MSGSSWLLLSLVAVTAAQSTIEELAKTFLEKFNQEAEDLSYQSALASWDYNTNITEENVQKMNDAEAKWS
AFYEEQSKLAKTYPSQEVQNLTVKRQLQALQQSGSSALSADKSKQLNTILSTMSTIYSTGKVCNQSNPQE
CFLLEPGLDEIMAKSTDYNERLWAWEGWRSVVGKQLRPLYEEYVVLKNEMARANNYEDYGDYWRADYEAE
GADGYDYSRSQLIDDVERTFSEIKPLYEQLHAYVRTKLMDAYPSRISPTGCLPAHLLGDMWGRFWTNLYS
LTVPFGQKPNIDVTDTMVNQGWDAERIFKEAEKFFVSVGLPSMTHGFWENSMLPESGDGRKVVCHPTAWD
LGKRDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSAATPEHLKS
IGLLPYDFHEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKEQWMQKWWEMKREIVGVVEP
MPHDETYCDPAALFHVANDYSFIRYYTRTIYQFQFQEALCQAAQHEGPLHKCDISNSTEAGQKLLNMLRL
GRSEPWTLALENVVGAKNMDVRPLLNYFEPLFTWLKEQNRNSFVGWSTEWTPYADQSIKVRISLKTALGD
QAYEWNDSEMYLFRSSVAYAMRKYFSEVKNQTILFGEEDVRVSDLKPRISFNFFVTAPNNVNDIIPRNEV
EEAISMSRSRINDIFRLDDNSLEFVGIQPTLEPPYESPVPIWLVVFGVVMGMIVIGIVVLIFTGIKDRRK
QKQAKREENPYGFVDMSKGENNSGFQNSDDIQTSF
>NP_001297119.1 angiotensin-converting enzyme 2 precursor [Mustela putorius furo]
MLGSSWLLLSLAALTAAQSTTEDLAKTFLEKFNYEAEELSYQNSLASWNYNTNITDENIQKMNIAGAKWS
AFYEEESQHAKTYPLEEIQDPIIKRQLRALQQSGSSVLSADKRERLNTILNAMSTIYSTGKACNPNNPQE
CLLLEPGLDDIMENSKDYNERLWAWEGWRSEVGKQLRPLYEEYVALKNEMARANNYEDYGDYWRGDYEEE
WADGYSYSRNQLIEDVEHTFTQIKPLYEHLHAYVRAKLMDAYPSRISPTGCLPAHLLGDMWGRFWTNLYP
LMVPFRQKPNIDVTDAMVNQSWDARRIFEEAETFFVSVGLPNMTEGFWQNSMLTEPGDNRKVVCHPTAWD
LGKRDFRIKMCTKVTMDDFLTAHHEMGHIQYDMAYAEQPFLLRNGANEGFHEAVGEIMSLSAATPNHLKN
IGLLPPDFSEDSETDINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKEQWMQKWWEMKRDIVGVVEP
LPHDETYCDPAALFHVANDYSFIRYYTRTIYQFQFQEALCQIAKHEGPLYKCDISNSSEAGQKLHEMLSL
GRSKPWTFALERVVGAKTMDVRPLLNYFEPLFTWLKEQNRNSFVGWNTDWSPYADQSIKVRISLKSALGE
KAYEWNDNEMYFFQSSIAYAMREYFSKVKNQTIPFVGKDVRVSDLKPRISFNFIVTSPENMSDIIPRADV
EEAIRKSRGRINDAFRLDDNSLEFLGIQPTLEPPYQPPVTIWLIVFGVVMGVVVVGIFLLIFSGIRNRRK
NNQARSEENPYASVDLSKGENNPGFQNVDDVQTSF
  • I went to the website www.phylogeny.fr. Then, I clicked 'Phylogeny analysis’, and clicked on the text ‘One Click'.
  • Then, I clicked on ‘Upload your set of sequences in FASTA, EMBL, or NEXUS format’. I copied the protein sequences from Week 4 Talk Page.
  • I used Command-V to paste my sequences in the field and clicked 'Submit".
    • In order to properly align the sequences, I first pasted them into a Word document.
  • I found the numbered tabs located just beneath the text One Click Mode, and clicked on the tab labeled 3. Alignment. Prior to this, I saw the pages named Alignment results, Phylogeny results, and Tree rendering results.
  • Positions are color-coded to indicate their conservation. Blue highlighting meant high conservation (the sequences are identical or very similar), gray highlighting means lower conservation, and white highlighting means little conservation.
  • Under Outputs, I clicked on Alignment in Clustal Format.
    • This showed my sequences with the amount of conservation indicated below them. The amount of conservation corresponded to the color-coded highlights shown above.
    • Key:
      • “*” for invariant
      • “:” for highly conserved
      • “.” for weakly conserved
      • Space for not conserved
    • Below are the class' alignments
XP_0234178      mrsggrgkMSgSfWfLLnLVAVTTAQfnlEEQAKTFLDeFNlkAEDLyYQSsLASWNYNT
NP_0012971      --------MlgSSWLLLSLaAlTaAQSttEdlAKTFLeKFNyEAEeLSYQnsLASWNYNT
NP_0013583      --------MSSSSWLLLSLVAVTaAQStIEEQAKTFLDKFNhEAEDLfYQSsLASWNYNT
ACI04574.1      --------MSgSSWLLLSLVAVTaAQStIEEQAKTFLDKFNhEAEDLfYQSsLASWNYNT
QHX39726.1      --------MSgSSWLLLSLVAVTaAQStIEElAKTFLeKFNQEAEDLSYQSALASWdYNT
XP_0327461      --------MSrSpWLLLSLVAVaTAQSLIEEkAesFLnKFNQEAEDLSYQSsLASWNYNT
XP_0287436      --------MSSSSWLLLSLVAVTTAQSIIEEQAKiFLDKFNQEAEDLSYQSALASWNYNT
XP_0360306      --------MSSSSWLLLSLVAVTTAQSIIEEQAKTFLDKFNQEAEDLSYQSALASWNYNT
XP_0050742      --------MSSSSWLLLSLVAVTTAQSIIEEQAKTFLDKFNQEAEDLSYQSALASWNYNT
XP_0272886      --------MSSSSWLLLSLVAVTTAQSIIEEQAKTFLDKFNQEAEDLSYQSALASWNYNT
XP_0234178      NITdENvQKMsEAggilSAFYEEQSnLAKaYPLQdIQNLTvKRQLriLQQSGSSgfSADK
NP_0012971      NITdENiQKMNiAgAKWSAFYEEeSqhAKtYPLeEIQdpiIKRQLrALQQSGSSvLSADK
NP_0013583      NITEENvQnMNnAgdKWSAFlkEQStLAqmYPLQEIQNLTvKlQLQALQQnGSSvLSeDK
ACI04574.1      NITEENvQnMNnAgeKWSAFlkEQStLAqmYPLQEIQNLTvKlQLQALQQnGSSvLSeDK
QHX39726.1      NITEENvQKMNDAeAKWSAFYEEQSKLAKtYPsQEvQNLTvKRQLQALQQSGSSALSADK
XP_0327461      NITEENAQKMNEAAAKWSAFYEEQSKiAqNfsLQEIQdaTIKRQLkALQQSGSSALSpDK
XP_0287436      NITEENAQKMNEAsAKWSAFYEEQSKLAKNYsLQEIpNLiIKRQLQALQQSGSSALSADK
XP_0360306      NITEENAQKMNEAAAKWSAFYEEQSKLAKNYsLQEIQNLiIKRQLQALQQSGSSALSADK
XP_0050742      NITEENAQKMNEAAAKWSAFYEEQSKLAKNYsLQEvQNLTIKRQLQALQQSGSSALSADK
XP_0272886      NITEENAQKMNEAAAKWSAFYEEQSKLAKNYsLQEvQNLiIKRQLQALQQSGSSALSADK
XP_0234178      NKQLsTILNTMSTlYSTGKVCyPsdPQECLLLEPGLaDIMskSTDYNlRLWAWEGWRskV
NP_0012971      rerLNTILNaMSTIYSTGKaCNPnNPQECLLLEPGLDDIMenSkDYNERLWAWEGWRsEV
NP_0013583      sKrLNTILNTMSTIYSTGKVCNPdNPQECLLLEPGLnEIMAnSlDYNERLWAWEsWRsEV
ACI04574.1      sKrLNTILNTMSTIYSTGKVCNPnNPQECLLLdPGLnEIMekSlDYNERLWAWEGWRsEV
QHX39726.1      sKQLNTILsTMSTIYSTGKVCNqsNPQECfLLEPGLDEIMAkSTDYNERLWAWEGWRsvV
XP_0327461      NKQLNTILNTMSTIYSTGKVCNsmNPQECfvLEPGLDEIMATSTDYNrRLWAWEGWRAEV
XP_0287436      tKQLNTILNaMSTIYSTGKVCkPKNPQECLLLEPGLDvIMATSTDYNERLWAWEGWRAEV
XP_0360306      NKQLNTILNaMSTIYSTGKVCkPKNPQECLLLEPGLDvIMATSTDYNERLWAWEGWRAEV
XP_0050742      NKQLNTILNTMSTIYSTGKVCNPKNPQECLLLEPGLDDIMATSTDYNERLWAWEGWRAEV
XP_0272886      NKQLNTILNTMSTIYSTGKVCNPKNPQECLLLEPGLDDIMATSTDYNERLWAWEGWRAEV
XP_0234178      GKQLRPLYEEYVaLKNEMARANkYEDYGDYWRrDYEvEdmDGYNYsRNQLIEDVERTFaE
NP_0012971      GKQLRPLYEEYVaLKNEMARANNYEDYGDYWRGDYEeEwADGYsYsRNQLIEDVEhTFtq
NP_0013583      GKQLRPLYEEYVVLKNEMARANhYEDYGDYWRGDYEvnGvDGYdYsRgQLIEDVEhTFEE
ACI04574.1      GKQLRPLYEEYVVLKNEMARANhYkDYGDYWRGDYEvnGvDGYdYNRdQLIEDVERTFEE
QHX39726.1      GKQLRPLYEEYVVLKNEMARANNYEDYGDYWRaDYEAEGADGYdYsRsQLIdDVERTFsE
XP_0327461      GKQLRPLYEEYVVLKNEMARANNYEDYGDYWRGDYEAEGveGYNYNRNQLIEDVEnTFKE
XP_0287436      GKQLRPLYEEYVVLKNEMARANNYrDYGDYWRGDYEAEGAeGYNYNRNQLIEDVERiFQE
XP_0360306      GKQLRPLYEEYVVLKNEMARANNYkDYGDYWRGgYEAEGAeGYNYNRNQLIEDVERTFQE
XP_0050742      GKQLRPLYEEYVVLKNEMARANNYEDYGDYWRGDYEAEGADGYNYNgNQLIEDVERTFKE
XP_0272886      GKQLRPLYEEYVVLKNEMARANNYkDYGDYWRGDYEAEGADGYNYNgNQLIEDVERTFKE
XP_0234178      IKPLYEQLHAYVRTKLMeTYPSrISPvGCLPAHLLGDMWGRFWTeLYsLTVPFqQKPNID
NP_0012971      IKPLYEhLHAYVRaKLMDaYPSrISPTGCLPAHLLGDMWGRFWTNLYPLmVPFrQKPNID
NP_0013583      IKPLYEhLHAYVRaKLMnaYPSYISPiGCLPAHLLGDMWGRFWTNLYsLTVPFGQKPNID
ACI04574.1      IKPLYEhLHAYVRaKLMnaYPSYISPTGCLPAHLLGDMWGRFWTNLYsLTVPFGQKPNID
QHX39726.1      IKPLYEQLHAYVRTKLMDaYPSrISPTGCLPAHLLGDMWGRFWTNLYsLTVPFGQKPNID
XP_0327461      IKPLYEQLHAYVRTKLMDvYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTtPFlQKPNID
XP_0287436      IKPLYEhLHAYVRTKLMDTYPSYInPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNID
XP_0360306      IKPLYEQLHAYVRTKLMDTYPSYInPTGCLPAHLLGDMWGRFWTNLYsLTVPFGQKPNID
XP_0050742      IKPLYEQLHAYVRTKLMnTYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNID
XP_0272886      IKPLYEQLHAYVRTKLMDTYPSFISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNID
XP_0234178      VTDAMesQsWDAEkIFKEAEKFFVSVGLPpMTQGFWkNSMLTePGDgqKVVCHPTAWDmG
NP_0012971      VTDAMVNQsWDArRIFeEAEtFFVSVGLPnMTeGFWQNSMLTePGDNRKVVCHPTAWDLG
NP_0013583      VTDAMVdQaWDAqRIFKEAEKFFVSVGLPnMTQGFWENSMLTDPGnvqKaVCHPTAWDLG
ACI04574.1      VTDAMVNQaWnAqRIFKEAEKFFVSVGLPnMTQGFWENSMLTDPGnvqKVVCHPTAWDLG
QHX39726.1      VTDtMVNQGWDAERIFKEAEKFFVSVGLPsMThGFWENSMLpesGDgRKVVCHPTAWDLG
XP_0327461      VTDAMVNQsWDAERIFKEAEKFFVSVGLPqMTpGFWtNSMLTePGDDRKVVCHPTAWDLG
XP_0287436      VTDAMlkQGWDAERIFKEAEKFFVSiGLPpMTQGFWENSMLvDPGDDRKVVCHPTAWDLG
XP_0360306      VTDAMmkQGWDAERIFKEAEKFFVSVGLPhMTQGFWENSMLvDPGDDRKVVCHPTAWDLG
XP_0050742      VTDAMVNQGWnAERIFKEAEKFFVSVGLPyMTQGFWENSMLTDPGDDRKVVCHPTAWDLG
XP_0272886      VTDAMVNQGWDAERIFKEAEKFFVSVGLPhMTQGFWgNSMLTDPGDDRKVVCHPTAWDLG
XP_0234178      KnDFRIKMCTKVTMDhFLTAHHEMGHIQYDMAYAiQPFLLRdGANEGFHEAiGEIMSLSA
NP_0012971      KrDFRIKMCTKVTMDdFLTAHHEMGHIQYDMAYAeQPFLLRNGANEGFHEAVGEIMSLSA
NP_0013583      KGDFRIlMCTKVTMDdFLTAHHEMGHIQYDMAYAaQPFLLRNGANEGFHEAVGEIMSLSA
ACI04574.1      KGDFRIiMCTKVTMDdFLTAHHEMGHIQYDMAYAaQPFLLRNGANEGFHEAVGEIMSLSA
QHX39726.1      KrDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSA
XP_0327461      hGDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYAkQPFLLRNGANEGFHEAVGEIMSLSA
XP_0287436      KGDFRIKMCTtVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSA
XP_0360306      KGDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSA
XP_0050742      KGDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSA
XP_0272886      KGDFRIKMCTKVTMDNFLTAHHEMGHIQYDMAYATQPFLLRNGANEGFHEAVGEIMSLSA
XP_0234178      ATPEHLKSIGLLPpDFHEDNgTkxNssLKQALTllGTLPFTfMLEKgegMVFtGEnPqEQ
NP_0012971      ATPnHLKnIGLLPpDFsEDsETdINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKEQ
NP_0013583      ATPkHLKSIGLLspDFqEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKdQ
ACI04574.1      ATPkHLKSIGLLspDFqEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKdQ
QHX39726.1      ATPEHLKSIGLLPyDFHEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKEQ
XP_0327461      ATPkHLKSIGLLPSnFqEDdETEINFLLKQALiIVGTLPFTYMLEKWRWMVFqdkIPrEQ
XP_0287436      ATPEHLKSIGLLPSDFrEDsETEINFLLKQALTIVGTLPFTYMLEKWRWMVFtGEIPKEQ
XP_0360306      ATPEHLKSIGLLPSDFHEDsETEINFLLKQALTIVGTLPFTYMLEKWRWMVFtGEIPKEQ
XP_0050742      ATPEHLKSIGLLPSDFqEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGdIPKEQ
XP_0272886      ATPkHLKSIGLLPSnFHEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGdIPKEk
XP_0234178      WieKxWqMKREIVGVVEPLPHDETYCDPAsLFHVSNDYSFIRYYTRTIYQFQFQEALCkA
NP_0012971      WMQKWWEMKRdIVGVVEPLPHDETYCDPAALFHVaNDYSFIRYYTRTIYQFQFQEALCQi
NP_0013583      WMkKWWEMKREIVGVVEPvPHDETYCDPAsLFHVSNDYSFIRYYTRTlYQFQFQEALCQA
ACI04574.1      WMkKWWEMKREIVGVVEPvPHDETYCDPAsLFHVSNDYSFIRYYTRTlYQFQFQEALCQA
QHX39726.1      WMQKWWEMKREIVGVVEPmPHDETYCDPAALFHVaNDYSFIRYYTRTIYQFQFQEALCQA
XP_0327461      WtQKWWEMKREIVGVVEPLPHDETYCDPAsLFHVSNDYSFIRYYTRTIYQFQFQEALCQA
XP_0287436      WMQKWWEMKREIVGVVEPLPHDETYCDPAALFHVSNDYSFIRYYTRTIYQFQFQEALCQA
XP_0360306      WMQKWWEMKREIVGVVEPLPHDETYCDPAALFHVSNDYSFIRYYTRTIYQFQFQEALCQA
XP_0050742      WMeKWWEMKREIVGVVEPLPHDETYCDPAALFHVSNDYSFIRYYTRTIYQFQFQEALCQA
XP_0272886      WMeKWWEMKREIVGVVEPLPHDETYCDPAALFHVSNDYSFIRYYTRTIYQFQFQEALCQA 
XP_0234178      AnHvGPLHKCDISNSTEAGQKLLNMLkLGKSEPWTLALEsiVGtKNMDVkPLLNYFqPLs
NP_0012971      AKHeGPLyKCDISNSsEAGQKLheMLsLGrSkPWTfALErVVGAKtMDVRPLLNYFEPLF
NP_0013583      AKHeGPLHKCDISNSTEAGQKLfNMLRLGKSEPWTLALENVVGAKNMnVRPLLNYFEPLF
ACI04574.1      AKHeGPLHKCDISNSTEAGQKLLNMLkLGKSEPWTLALENVVGAKNMnVRPLLNYFEPLF
QHX39726.1      AqHeGPLHKCDISNSTEAGQKLLNMLRLGrSEPWTLALENVVGAKNMDVRPLLNYFEPLF
XP_0327461      AKHDGPLHKCDISNSTEAGQKLLNMLsLGnSgPWTLALENVVGsrNMDVkPLLNYFqPLF
XP_0287436      AKHDGPLHKCDISNSTEAGQKLLNMLRLGnSEPWTLALENVVGArNMDVRPLLNYFEPLF
XP_0360306      AKyDGPLHKCDISNSTEAGQKLLNMLRLGnSEPWTLALENVVGArNMDVRPLLNYFEPLF
XP_0050742      AKHDGPLHKCDISNSTEAGQKLLNMLRLGKSEPWTLALENVVGArNMDVRPLLNYFEPLs
XP_0272886      AKHDGPLHKCDISNSTEAGQKLLNMLRLGKSEPWTLALENVVGArNMDVRPLLNYFEPLs
XP_0234178      TWLqdQNrNSFVGWNTeWSP--YseeSIKVRISLKSALGEdAYkWdDNEMYLFRSSVAYA
NP_0012971      TWLKEQNrNSFVGWNTDWSP--YADQSIKVRISLKSALGEkAYEWNDNEMYfFqSSiAYA
NP_0013583      TWLKdQNKNSFVGWsTDWSP--YADQSIKVRISLKSALGdkAYEWNDNEMYLFRSSVAYA
ACI04574.1      TWLKdQNKNSFVGWsTDWSP--YADQSIKVRISLKSALGdkAYEWNDNEMYLFRSSVAYA
QHX39726.1      TWLKEQNrNSFVGWsTeWtP--YADQSIKVRISLKtALGdqAYEWNDsEMYLFRSSVAYA
XP_0327461      vWLKEQNsNStVGWNTDWSPcdftDct--------------hYEWtDNEMYLFRSSVAYA
XP_0287436      aWLKEQNKNSlVGWNTDWSP--YADQSIKVRISLKSALGkNAYEWNDNEMYLFRSSVAYA
XP_0360306      aWLKEQNKNSlVGWNTDWSP--YADQSIKVRISLKSALGkNAYEWNDNEMYLFRSSVAYA
XP_0050742      vWLKEQNKNSFVGWNTDWSP--YADQSIKVRISLKSALGENAYEWdDNEMYLFRaSVAYA
XP_0272886      vWLKEQNKNSFVGWNTDWSP--YADQSIKVRISLKSALGENAYEWNDNEMYLFRatVAYA
XP_0234178      MRkYFldvKNQTVLFswEDVRVSDwthRVSFtFFVTePnNVSnIIPktEVEdAIRlSRsR
NP_0012971      MReYFSKvKNQTipFvgkDVRVSDLKPRiSFNFiVTSPENmSDIIPRadVEEAIRkSRGR
NP_0013583      MRqYFlKvKNQmiLFGeEDVRVanLKPRiSFNFFVTaPkNVSDIIPRtEVEkAIRmSRsR
ACI04574.1      MRtYFleiKhQTiLFGeEDVRVaDLKPRiSFNFyVTaPkNVSDIIPRtEVEEAIRiSRsR
QHX39726.1      MRkYFSevKNQTiLFGeEDVRVSDLKPRiSFNFFVTaPnNVnDIIPRNEVEEAIsmSRsR
XP_0327461      MReYFSReKNQTVpFGeaDVwVSDLKPRVSFNFFVTSPkNVSDIIPRSEVEEAIRmSRGR
XP_0287436      MRvYFAmnKtQnVpFGvEDihVSDLKPRVSFNFFVTSPQNVSDIIPRkdVEdAIRFSRGR
XP_0360306      MRvYFAKnKtQiVpFGvEDihVSDLKPRVSFNFFVTSPQNVSDIIPRkEVEdAIRFSRGR
XP_0050742      MRvYFAKnKtQTVpFGvEDiRVSDLKPRVSFNFFVTSPQNVSDIIPRNEVEEAvRlSRGR
XP_0272886      MRvYFAKnKtQTVLFGvEDiRVSDLKPRVSFNFFVTSPQNVSDIIPRNEVEEAvRFSRGR
XP_0234178      INDVFrLgxxhsgvsGIyPTLSPPYePPVTIWLIvFGVVMGlVVVGIVvLviTGIrDRrK
NP_0012971      INDaFrLDDNSLEFLGIQPTLePPYQPPVTIWLIvFGVVMGVVVVGIflLIFsGIrnRrK
NP_0013583      INDaFrLnDNSLEFLGIQPTLgPPnQPPVsIWLIvFGVVMGViVVGIVILIFTGIrDRKK
ACI04574.1      INDaFrLnDNSLEFLGIQtTLAPPYQsPVTtWLIvFGVVMGViVaGIVvLIFTGIrDRKK
QHX39726.1      INDIFrLDDNSLEFvGIQPTLePPYesPVpIWLvvFGVVMGmiVIGIVvLIFTGIKDRrK
XP_0327461      INDIFGLnDNSLEFLGIyPTLkPPYePPVTIWLIIFGVVMGmVVVGIVILIvTGIKgRKK
XP_0287436      INDVFGLDDNSLEFLGIyPTLAPPYQPPVTIWLIIFGiVMGIVVVGIVILIFTGIKgRKK
XP_0360306      INDVFGLDDNSLEFLGIyPTLAPPYQPPVTIWLIIFGVVMGIVVVGIVILIFTGIKgRKK
XP_0050742      INDVFGLDDNSLEFLGInPTLSPPYQPPVTIWLIIFGVVMGIVVVGIIILIFTGIKgRKK
XP_0272886      INDVFGLDDNSLEFLGInPTLAPPYQPPVTIWLIIFGVVMGIVVVGIVILIvTGIraRKK
XP_0234178      KkqkqREENPYsSVDIGKGENNtaFQNseDnQTSF
NP_0012971      nNqArsEENPYaSVDlsKGENNpGFQNvDDVQTSF
NP_0013583      KNkArsgENPYaSIDIsKGENNpGFQNtDDVQTSF
ACI04574.1      KNqArsEENPYaSIDInKGENNpGFQNtDDVQTSF
QHX39726.1      qkqAKREENPYgfVDmsKGENNsGFQNsDDIQTSF
XP_0327461      KNEtKREENPYDSVDIGKGEsNAGFQNsDDaQTSF
XP_0287436      KNEtKREENPYDSmDIGKGEsNAGFQNNDDaQTSF
XP_0360306      KNEtKREENPYDSmDIGKGEsNAGFQNNDDVQTSF
XP_0050742      KNEtKREENPYDSVDIGKGEsNAGFlsNDDaQTSF
XP_0272886      nNEAKREENPYDSVDIGKGEsNAGFQsNDDVQTSF
  • Below is the phylogenetic tree created for the small animal model

Horvath Small Animal Tree.png

  • Navigated to LALIGN, a platform used by researchers to find a percent identity for sequences.
    • Allows for the comparison of two different sequences.
  • Entered human ACE2 sequence in area called 1st Query sequence.
  • Entered one of the other sequences into the 2nd Query sequence'.
  • Clicked Run LALIGN.
  • Noted the percent similarity between the sequences.
    • Recorded this value in a table.
  • Repeated procedure for other sequences, comparing each to the human and ACE2 sequence.
  • Created a table showing the percent similarity of each organism to humans.

Horvath Sequence Similarity.png

Aiden

  • First I copied the sequences and directions above in order to generate the sequence alignments in clustal form.
  • Next I referred to the Wan et al. 2020 paper to find the locations of critical ACE2 redidues.
  • I used the information found above to identify these critical residues for all of the aligned ACE2 sequences.
  • After doing this manually I generated the following graph highlighting variances from the human ACE2 critical residues

Aiden ACE2 comparasin chart.jpg

Taylor

  • First, I navigated to the NIH Web BLAST Homepage
  • I then clicked on the blue Protein BLAST icon towards the right of the screen
  • Next, I navigated to the first input box titled Enter Query Sequence and put in the accession numbers for the ACE2 sequences of our 9 small animal models
    • I then checked the box (located below the first input box) titled "Align two or more sequences
  • Then, in the next input box titled Enter Subject Sequence I entered the accession number for the human ACE2 sequence
  • I then clicked the blue BLAST button at the bottom of the page to run the alignment
  • I then noted and took screenshots of the following chart (found under the Descriptions tab), mainly to note the percent identity

Makela Percent Identity Table.png

  • I then clicked on the Alignments tab where I analyzed and took screenshots of all 9 alignments:
  • Rhesus Monkey

Makela Rhesus Monkey.png

  • Rabbit

Makela Rabbit.png

  • Golden Hamster

Makela Golden Hamster.png

  • Chinese Hamster

Makela Chinese Hamster.png

  • Southern Grasshopper Mouse

Makela Southern Grasshopper Mouse.png

  • White Footed Mouse

Makela White Footed Mouse.png

  • Domestic Ferret

Makela Domestic Ferret.png

  • Black Rat

Makela Black Rat.png

  • Domestic Guinea Pig

Makela Domestic Guinea Pig.png

Nida

Acknowledgements

  1. Aiden Burnett, Nida Patel, Anna Horvath, and Taylor Makela met over Zoom & used an sms group chat to coordinate and develop the above research project.
  2. Kam D. Dahlquist, Ph.D. reviewed and advised our project while in development.
  3. Except for what is noted above, this individual journal entry was completed by me and not copied from another source.

Taylor Makela (talk) 21:11, 25 January 2021 (PST)

References

  1. Angiotensin-converting enzyme 2 isoform 1 precursor [Homo sapiens] - Protein - NCBI. (2020). Retrieved 6 December 2020, from https://www.uniprot.org/uniprot/Q9BYF1.fasta
  2. Angiotensin-converting enzyme 2 Syrian Hamster - Protein - NCBI. (2020). Retrieved 6 December 2020, from https://www.ncbi.nlm.nih.gov/protein/XP_005074266.1?report=fasta
  3. Angiotensin-converting enzyme 2 Chinese Hamster - Protein - NCBI. (2020). Retrieved 6 December 2020, from https://www.ncbi.nlm.nih.gov/protein/AGZ48803.1?report=fasta
  4. Angiotensin-converting enzyme 2 precursor White-footed Mouse - Protein - NCBI. (2020). Retrieved 6 December 2020, from https://www.ncbi.nlm.nih.gov/protein/XP_028743609.1?report=fasta
  5. angiotensin converting enzyme 2 Southern Grasshopper Mouse - Protein - NCBI. (2020). Retrieved 6 December 2020, from https://www.ncbi.nlm.nih.gov/protein/XP_036030683.1?report=fasta
  6. Angiotensin-converting enzyme 2 precursor Black Rat - Protein - NCBI. (2020). Retrieved 6 December 2020, from https://www.ncbi.nlm.nih.gov/protein/XP_032746145.1?report=fasta
  7. Angiotensin I converting enzyme 2 Domestic Guinea Pig - Protein - NCBI. (2020). Retrieved 6 December 2020, from https://www.ncbi.nlm.nih.gov/protein/XP_023417808.1?report=fasta
  8. Angiotensin I converting enzyme 2 Rhesus Monkey - Protein - NCBI. (2020). Retrieved 6 December 2020, from https://www.ncbi.nlm.nih.gov/protein/ACI04574.1?report=fasta
  9. Angiotensin-converting enzyme 2 precursor Rabbit - Protein - NCBI. (2020). Retrieved 6 December 2020, from https://www.ncbi.nlm.nih.gov/protein/QHX39726.1?report=fasta
  10. Angiotensin converting enzyme 2 Domestic Ferret - Protein - NCBI. (2020). Retrieved 6 December 2020, from https://www.ncbi.nlm.nih.gov/protein/NP_001297119.1?report=fasta
  11. LALIGN Server. (2020). Retrieved 6 December 2020, from https://embnet.vital-it.ch/software/LALIGN_form.html
  12. OpenWetWare. (2020). BIOL368/F20:Week 12. Retrieved 3 December 2020, from https://openwetware.org/wiki/BIOL368/F20:Week_12
  13. Phylogeny.fr: "One Click" Mode. (2020). Retrieved 6 December 2020, from http://www.phylogeny.fr/simple_phylogeny.cgi?workflow_id=b9c0813cbbe9695d63cf7e31da5f026d&tab_index=1
  14. Wan, Y., Shang, J., Graham, R., Baric, R., & Li, F. (2020). Receptor Recognition by the Novel Coronavirus from Wuhan: an Analysis Based on Decade-Long Structural Studies of SARS Coronavirus. Journal Of Virology, 94(7). doi: 10.1128/jvi.00127-20 Yuan, S., Jiang, S., & Li, Z. (2020). Analysis of Possible Intermediate Hosts of the New Coronavirus SARS-CoV-2. Frontiers In Veterinary Science, 7. doi: 10.3389/fvets.2020.00379
  15. Miao, J., Chard, L. S., Wang, Z., & Wang, Y. (2019). Syrian Hamster as an Animal Model for the Study on Infectious Diseases. Frontiers in immunology, 10, 2329. https://doi.org/10.3389/fimmu.2019.02329

Presentation

Media:AH_TM_AB_NP_Presentation.pdf

Templates

Taylor Makela

Template Links

Assignment Pages

Individual Journal Pages

Class Journal Pages

Nida Patel

Template Links

Assignment Pages


Individual Journal Pages

Class Journal Pages

Anna Horvath

Template

Anna Horvath Template

User Pages

Assignments

Journal Pages

Class Journal Pages

Aiden Burnett

User Page

Aiden Burnett

Template

Aiden Burnett Template

Course Homepage

BIOL368/F20

Weekly Assignments

Individual Journal Pages

Class Journal Pages