Anna Horvath Week 6

From OpenWetWare
Jump to navigationJump to search


To determine, through a comparison of eighteen different ACE-2 sequences, which of them are likely intermediary host for SARS-CoV-2, which has the most similar ACE2 receptor to humans. This could then be used to inform future comparisons of coronaviruses by understanding the ACE-2 similarities


Part 1: GenBank

  • I went to GenBank in order to find the nineteen sequences.
  • Sequences used included:
    • humans [2]
    • civet [3]
    • Chinese bats [4]
    • mice [5]
    • rats [6]
    • pigs [7]
    • ferrets [8]
    • cats [9]
    • orangutans [10]
    • grivet monkeys [11]
    • fox [12]
    • chickens [13]
    • king cobras [14]
    • pangolins [15]
    • dromedary camels [16]
    • squirrels [17]
    • mink [18]
    • Chinese softshell turtles [19]
>NP_001358344.1 angiotensin-converting enzyme 2 isoform 1 precursor [Homo sapiens]
>AAX63775.1 angiotensin-converting enzyme 2 [Paguma larvata]
>AGZ48803.1 angiotensin-converting enzyme 2 [Rhinolophus sinicus]
>NP_001123985.1 angiotensin-converting enzyme 2 precursor [Mus musculus]
>AAW78017.1 angiotensin converting enzyme 2 [Rattus norvegicus]
>NP_001116542.1 angiotensin-converting enzyme 2 precursor [Sus scrofa]
>BAE53380.1 angiotensin I converting enzyme 2 [Mustela putorius furo]
>AAX59005.1 angiotensin I converting enzyme 2 [Felis catus]
>NP_001124604.1 angiotensin-converting enzyme 2 precursor [Pongo abelii]

>AAY57872.1 angiotensin converting enzyme 2 [Chlorocebus aethiops]

Part 2: Creating a sequence alignment with

  • I went to the website Then, I clicked 'Phylogeny analysis’, and clicked on the text ‘One Click'.
  • Then, I clicked on ‘Upload your set of sequences in FASTA, EMBL, or NEXUS format’. I copied the protein sequences from Week 4 Talk Page.
  • I used Command-V to paste my sequences in the field and clicked 'Submit".
    • In order to properly align the sequences, I first pasted them into a Word document.
  • I found the numbered tabs located just beneath the text One Click Mode, and clicked on the tab labeled 3. Alignment. Prior to this, I saw the pages named Alignment results, Phylogeny results, and Tree rendering results.
  • Positions are color-coded to indicate their conservation. Blue highlighting meant high conservation (the sequences are identical or very similar), gray highlighting means lower conservation, and white highlighting means little conservation.
  • Under Outputs, I clicked on Alignment in Clustal Format.
    • This showed my sequences with the amount of conservation indicated below them. The amount of conservation corresponded to the color-coded highlights shown above.
    • Key:
      • “*” for invariant
      • “:” for highly conserved
      • “.” for weakly conserved
      • Space for not conserved
    • Below are the class' alignments
XP_0061228      ----------MLSHL---------------WILC--SLTVVVKSQDITQE-AINFLSEFN
XP_416822.      ----------MLLHF---------------WLLC--GLSAVVTPQDVTQE-AQTFLAEFN
AGZ48803.1      ----------MSGSS---------------WLLL--SLVAVTTAQSTTEDEAKMFLDKFN
NP_0011165      ----------MSGSF---------------WLLL--SLIPVTAAQSTTEELAKTFLEKFN
XP_0313017      ----------MSGSF---------------WLLL--SLVAVTAAQSTTEELAKTFLEEFN
QLH93383.1      ----------MSGSS---------------WLLL--SLVAVTAAQSTSDEEAKTFLEKFN
BAE53380.1      ----------MLGSS---------------WLLL--SLAALTAAQSTTEDLAKTFLEKFN
CCP86723.1      ------------------------------------------------------------
XP_0258425      ----------MSGSS---------------WLLL--SLAALTAAQST-EDLVNTFLEKFN
AAX63775.1      ----------MSGSF---------------WLLL--SFAALTAAQSTTEELAKTFLETFN
AAX59005.1      ----------MSGSF---------------WLLL--SFAALTAAQSTTEELAKTFLEKFN
NP_0011239      ----------MSSSS---------------WLLL--SLVAVTTAQSLTEENAKTFLNNFN
AAW78017.1      ----------MSSSC---------------WLLL--SLVAVATAQSLIEEKAESFLNKFN
AAY57872.1      ----------MSSSS---------------WLLL--SLVAVTAAQSTIEEQAKTFLDKFN
NP_0013583      ----------MSSSS---------------WLLL--SLVAVTAAQSTIEEQAKTFLDKFN
NP_0011246      ----------MSGSS---------------WLLL--SLVAVTAAQSTIEEQAKTFLDKFN
CCP86723.1      ------------------------------------------------------------
CCP86723.1      ------------------------------------------------------------
NP_0011246      KLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPNNPQECLLLEPGLNEIMA                                                                            

CCP86723.1      ------------------------------------------------------------
NP_0011246      NSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGVD                                                                            

CCP86723.1      ------------------------------------------------------------
CCP86723.1      ----------------------------------------------GLPNMTEGFWQNSM
                                                              ** :**  ** ***
                : :* . .*.********: : *:** ****:.*::***.*******:*****:  .:**
                *.************:****.:**::** :.** . * ** **:*********.****:**
                ************   *..::* : **:*** ****:**:**:* *****.*:**::*:**
                *******:::***:****. * :   *:.***::*  **  * .:* :* * .** :** 
                 ..   *.. *:  **:**  **   *    :**.. * **: ::********:*** .*
ETE61880.1      YNWDESEMFLFKSTIAYAMQKYFLEVKNKTVPF---------------------------
                * *  .*:::*.*::****. **   : : : *                           
                               *.**.  * * *::*** *: .** ..  .*:: **: **:*:. 
ETE61880.1      IVIGIITLEKAGSKN---------------------------------------------
                :* *:. *  :* ..                                             
XP_0061228      SF
XP_416822.      SF
ETE61880.1      --
AGZ48803.1      SF
NP_0011165      SF
XP_0313017      SF
QLH93383.1      SF
BAE53380.1      SF
CCP86723.1      --
XP_0258425      SF
AAX63775.1      SF
AAX59005.1      SF
NP_0011239      SF
AAW78017.1      SF
XP_0053160      SF
AAY57872.1      SF
NP_0013583      SF
NP_0011246      SF

New alignment:

AGZ48803.1      ----------MSGSS---------------WLLL--SLVAVTTAQSTTEDEAKMFLDKFN
NP_0011165      ----------MSGSF---------------WLLL--SLIPVTAAQSTTEELAKTFLEKFN
XP_0313017      ----------MSGSF---------------WLLL--SLVAVTAAQSTTEELAKTFLEEFN
QLH93383.1      ----------MSGSS---------------WLLL--SLVAVTAAQSTSDEEAKTFLEKFN
BAE53380.1      ----------MLGSS---------------WLLL--SLAALTAAQSTTEDLAKTFLEKFN
XP_0258425      ----------MSGSS---------------WLLL--SLAALTAAQST-EDLVNTFLEKFN
AAX63775.1      ----------MSGSF---------------WLLL--SFAALTAAQSTTEELAKTFLETFN
AAX59005.1      ----------MSGSF---------------WLLL--SFAALTAAQSTTEELAKTFLEKFN
NP_0011239      ----------MSSSS---------------WLLL--SLVAVTTAQSLTEENAKTFLNNFN
AAW78017.1      ----------MSSSC---------------WLLL--SLVAVATAQSLIEEKAESFLNKFN
AAY57872.1      ----------MSSSS---------------WLLL--SLVAVTAAQSTIEEQAKTFLDKFN
NP_0013583      ----------MSSSS---------------WLLL--SLVAVTAAQSTIEEQAKTFLDKFN
NP_0011246      ----------MSGSS---------------WLLL--SLVAVTAAQSTIEEQAKTFLDKFN
XP_0061228      ----------MLSHL---------------WILC--SLTVVVKSQDITQEAIN-FLSEFN
XP_416822.      ----------MLLHF---------------WLLC--GLSAVVTPQDVTQE-AQTFLAEFN
                                              *:    .:  :. .*.  .   : **  *:
                  * :: :  *:*:*  ***:.:*. . *      :: :  * .  *  : :  *     
                . *:. **  *:.  : :    * .::  ***::*                   *: ** 
                .. :*  ***.**.**::**. :* *** ** *:*: **   * ******* :**     
                   *.* :*: ***  * :       ****** .* . * .  *.  *.:**********
                ******* * .*: :*..****. * .: * .  **: ** ** *:** :**  ** ***
                : :* . .*.********: : *:** ****:.*::***.*******:*****:  .:**
                *.************:****.:**::** :.** . * ** **:*********.****:**
                ************   *..::* : **:*** ****:**:**:* *****.*:**::*:**
                *******:::***:****. * :   *:.***::*  **  * .:* :* * .** :** 
                 ..   *.. *:  **:**  **   *    :**.. * **: ::********:*** .*
ETE61880.1      YNWDESEMFLFKSTIAYAMQKYFLEVKNKTVPF---------------------------
                * *  .*:::*.*::****. **   : : : *                           
                               *.**.  * * *::*** *: .** ..  .*:: **: **:*:. 
ETE61880.1      IVIGIITLEKAGSKN---------------------------------------------
                :* *:. *  :* ..                                             
AGZ48803.1      SF
NP_0011165      SF
XP_0313017      SF
QLH93383.1      SF
BAE53380.1      SF
XP_0258425      SF
AAX63775.1      SF
AAX59005.1      SF
NP_0011239      SF
AAW78017.1      SF
XP_0053160      SF
AAY57872.1      SF
NP_0013583      SF
NP_0011246      SF
ETE61880.1      --
XP_0061228      SF
XP_416822.      SF

Part 3: Creating a phylogenetic tree with

  • Continued working with the website.
  • Went back to 6. Tree rendering for the phylogenetic tree of the sequences.
    • Horizontal lines represent individual evolutionary lines.
    • Vertical lines represent mutation events. the vertical length has no biological meaning.
    • The left-most split is called the root of the tree, which represents a hypothesis about the most recent common ancestor (MRCA) of the sequences within your tree.
    • The length of each branch represents the percentage change in the amino acid sequence occurring along that branch, relative to the scale bar
      • The scale bar was 0.5 (50%).
  • I saved the image to a file and uploaded it to the wiki.

Mink phylogenetic tree.png

  • Original image included the American mink. After further analysis of this partial sequence, this sequence was removed.
  • The new phylogenetic tree is visible below:

No mink phylogenetic tree.png

Part 4: Structural Analysis and Critical Residues Table

  • My research partner, Aiden Burnett, performed a structural analysis of the ACE2 receptor.
  • Aiden Burnett also created a table detailing the differences between the critical amino acid residues.
  • The methods by which he did these can both be found on his user page.

Part 5: Sequence Percent Similarity Table

  • Navigated to LALIGN, a platform used by researchers to find a percent identity for sequences.
    • Allows for the comparison of two different sequences.
  • Entered human ACE2 sequence in area called 1st Query sequence.
  • Entered one of the other seventeen sequences into the ;2nd Query sequence'.
  • Clicked Run LALIGN.
  • Noted the percent similarity between the sequences.
    • Recorded this value in a table.
  • Repeated procedure for other sixteen sequences, comparing each to the human ACE2 sequence.
  • Created a table showing the percent similarity of each organism to humans.

Horvath Percent Similarity.png

Part 6: Final Presentation

  • Uploaded presentation created based on the information presented above.

Presentation Slides (PDF)

Scientific Conclusion

  • Known human orthologues, including monkeys and orangutans, showed close similarities to the human ACE2 sequences. Foxes and cats also showed similarities, while turtles and king cobras did not show to be similar. Of the five critical amino acids that correspond to the RBD of SARS-CoV-2 on the ACE2 receptor, many were relatively conserved across species, with most organisms having between 2-3 of the 5 amino acids altered. This could help study the lineage of SARS-CoV-2 and identify which animals could act as intermediary hosts for future strains of SARS viruses.


  • I consulted with my partner Aiden Burnett in class, over text, as well as over the phone several times to discuss the creation of our presentation.
  • I contacted my TA, Annika Dinulos, to ask about the formatting of a presentation.
  • I copied and modified procedures from the Week 6 assignment page.
  • I referred back to procedures used on my Week 4 and Week 5 pages.
  • I used the Wan et. al - Receptor Recognition by the Novel Coronavirus from Wuhan paper for reference.
  • I obtained sequences from GenBank.
  • I built the phylogenetic tree and created sequence alignments using
  • I used LALIGN to compare sequence percent similarities.
  • I uploaded images using the Wiki Upload page.
  • I copied and modified wiki syntax on formatting a photo from the Media Wiki Help Page.
  • Except for what is noted above, this individual journal entry was completed by me and not copied from another source.

Anna Horvath (talk) 21:25, 14 October 2020 (PDT)


  1. Andersen, K., Rambaut, A., Lipkin, W., Holmes, E., & Garry, R. (2020). The proximal origin of SARS-CoV-2. Nature Medicine, 26(4), 450-452. doi: 10.1038/s41591-020-0820-9
  2. Angiotensin-converting enzyme 2 isoform 1 precursor [Homo sapiens] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  3. Angiotensin-converting enzyme 2 [Paguma larvata] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  4. Angiotensin-converting enzyme 2 [Rhinolophus sinicus] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  5. Angiotensin-converting enzyme 2 precursor [Mus musculus] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  6. angiotensin converting enzyme 2 [Rattus norvegicus] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  7. Angiotensin-converting enzyme 2 precursor [Sus scrofa] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  8. Angiotensin I converting enzyme 2 [Mustela putorius furo] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  9. Angiotensin I converting enzyme 2 [Felis catus] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  10. Angiotensin-converting enzyme 2 precursor [Pongo abelii] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  11. Angiotensin converting enzyme 2 [Chlorocebus aethiops] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  12. Angiotensin-converting enzyme 2 [Vulpes vulpes] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  13. Angiotensin-converting enzyme 2 [Gallus gallus] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  14. Angiotensin-converting enzyme 2 [Ophiophagus hannah] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  15. Angiotensin I converting enzyme 2 [Manis pentadactyla] - Protein - NCBI. (n.d.). Retrieved October 08, 2020, from
  16. Angiotensin-converting enzyme 2 [Camelus dromedarius] - Protein - NCBI. (n.d.). Retrieved October 08, 2020, from
  17. Angiotensin-converting enzyme 2, partial [Neovison vison] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  18. Angiotensin-converting enzyme 2 [Ictidomys tridecemlineatus] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  19. Angiotensin-converting enzyme 2 [Pelodiscus sinensis] - Protein - NCBI. (2020). Retrieved 8 October 2020, from
  20. Deng, J., Jin, Y., Liu, Y., Sun, J., Hao, L., & Bai, J. et al. (2020). Serological survey of SARS‐CoV‐2 for experimental, domestic, companion and wild animals excludes intermediate hosts of 35 different species of animals. Transboundary And Emerging Diseases, 67(4), 1745-1749. doi: 10.1111/tbed.13577
  21. LALIGN Server. (2020). Retrieved 14 October 2020, from
  22. OpenWetWare - Anna Horvath Week 4. (2020). Retrieved 14 October 2020, from
  23. OpenWetWare - Anna Horvath Week 5. (2020). Retrieved 14 October 2020, from
  24. OpenWetWare - BIOL368/F20:Week 6. (2020). Retrieved 14 October 2020, from
  25. "One Click" Mode. (2020). Retrieved 8 October 2020, from
  26. Wan, Y., Shang, J., Graham, R., Baric, R., & Li, F. (2020). Receptor Recognition by the Novel Coronavirus from Wuhan: an Analysis Based on Decade-Long Structural Studies of SARS Coronavirus. Journal Of Virology, 94(7). doi: 10.1128/jvi.00127-20
  27. Yuan, S., Jiang, S., & Li, Z. (2020). Analysis of Possible Intermediate Hosts of the New Coronavirus SARS-CoV-2. Frontiers In Veterinary Science, 7. doi: 10.3389/fvets.2020.00379
  28. Zhao, J., Cui, W., & Tian, B. (2020). The Potential Intermediate Hosts for SARS-CoV-2. Frontiers In Microbiology, 11. doi: 10.3389/fmicb.2020.580137


Anna Horvath Template

User Pages


Journal Pages

Class Journal Pages