Taylor Makela Journal Week 6

From OpenWetWare
Jump to navigationJump to search

Taylor Makela Week 6

Purpose

  • The purpose of this assignment was to test whether COVID-19 transmission from human host to 11 other species is possible based on their individual ACE2 sequences.
    • Using the UniProt and Genbank Database the ACE2 sequences of 12 species including humans, mice, pangolins, civets, ferrets, bats, rats, monkeys, orangutans, cats, dogs, and pigs and were compared to see if species to species transmission is possible.

Methods/Results

Compiled ACE2 sequences

  • Using Genbank and Uniprot databases the ACE2 receptor sequences for the 12 species were found
    • The databases contain information regarding the source organism, the locus of the sequence, the virus, and a referenced authors page.
  • The ACE2 sequences for the 13 species are as follows:
    • HUMAN/ Homo sapiens: [1]
>sp|Q9BYF1|ACE2_HUMAN Angiotensin-converting enzyme 2 
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL
NTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY
EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHL
HAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM
CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM
KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH
KCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKN
QMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN
SLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENP
YASIDISKGENNPGFQNTDDVQTSF
    • MOUSE/ Mus musculus:[2]:
>sp|Q8R0I0|ACE2_MOUSE Angiotensin-converting enzyme 2 OS=Mus musculus 
MSSSSWLLLSLVAVTTAQSLTEENAKTFLNNFNQEAEDLSYQSSLASWNYNTNITEENAQ
KMSEAAAKWSAFYEEQSKTAQSFSLQEIQTPIIKRQLQALQQSGSSALSADKNKQLNTIL
NTMSTIYSTGKVCNPKNPQECLLLEPGLDEIMATSTDYNSRLWAWEGWRAEVGKQLRPLY
EEYVVLKNEMARANNYNDYGDYWRGDYEAEGADGYNYNRNQLIEDVERTFAEIKPLYEHL
HAYVRRKLMDTYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTVPFAQKPNIDVTDAMMNQ
GWDAERIFQEAEKFFVSVGLPHMTQGFWANSMLTEPADGRKVVCHPTAWDLGHGDFRIKM
CTKVTMDNFLTAHHEMGHIQYDMAYARQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLPSDFQEDSETEINFLLKQALTIVGTLPFTYMLEKWRWMVFRGEIPKEQWMKKWWEM
KREIVGVVEPLPHDETYCDPASLFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKYNGSLH
KCDISNSTEAGQKLLKMLSLGNSEPWTKALENVVGARNMDVKPLLNYFQPLFDWLKEQNR 
NSFVGWNTEWSPYADQSIKVRISLKSALGANAYEWTNNEMFLFRSSVAYAMRKYFSIIKN
QTVPFLEEDVRVSDLKPRVSFYFFVTSPQNVSDVIPRSEVEDAIRMSRGRINDVFGLNDN
SLEFLGIHPTLEPPYQPPVTIWLIIFGVVMALVVVGIIILIVTGIKGRKKKNETKREENP
YDSMDIGKGESNAGFQNSDDAQTSF
    • RAT/ Rattus norvegicus:
>sp|Q5EGZ1|ACE2_RAT Angiotensin-converting enzyme 2 OS=Rattus norvegicus
MSSSCWLLLSLVAVATAQSLIEEKAESFLNKFNQEAEDLSYQSSLASWNYNTNITEENAQ
KMNEAAAKWSAFYEEQSKIAQNFSLQEIQNATIKRQLKALQQSGSSALSPDKNKQLNTIL
NTMSTIYSTGKVCNSMNPQECFLLEPGLDEIMATSTDYNRRLWAWEGWRAEVGKQLRPLY
EEYVVLKNEMARANNYEDYGDYWRGDYEAEGVEGYNYNRNQLIEDVENTFKEIKPLYEQL
HAYVRTKLMEVYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTTPFLQKPNIDVTDAMVNQ
SWDAERIFKEAEKFFVSVGLPQMTPGFWTNSMLTEPGDDRKVVCHPTAWDLGHGDFRIKM
CTKVTMDNFLTAHHEMGHIQYDMAYAKQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLPSNFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFQDKIPREQWTKKWWEM
KREIVGVVEPLPHDETYCDPASLFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKHDGPLH
KCDISNSTEAGQKLLNMLSLGNSGPWTLALENVVGSRNMDVKPLLNYFQPLFVWLKEQNR
NSTVGWSTDWSPYADQSIKVRISLKSALGKNAYEWTDNEMYLFRSSVAYAMREYFSREKN
QTVPFGEADVWVSDLKPRVSFNFFVTSPKNVSDIIPRSEVEEAIRMSRGRINDIFGLNDN
SLEFLGIYPTLKPPYEPPVTIWLIIFGVVMGTVVVGIVILIVTGIKGRKKKNETKREENP
YDSMDIGKGESNAGFQNSDDAQTSF
    • PALM CIVET/Paguma larvata [3]
>sp|Q56NL1|ACE2_PAGLA Angiotensin-converting enzyme 2 OS=Paguma    
lavarta
MSGSFWLLLSFAALTAAQSTTEELAKTFLETFNYEAQELSYQSSVASWNYNTNITDENAK
NMNEAGAKWSAYYEEQSKLAQTYPLAEIQDAKIKRQLQALQQSGSSVLSADKSQRLNTIL
NAMSTIYSTGKACNPNNPQECLLLEPGLDNIMENSKDYNERLWAWEGWRAEVGKQLRPLY
EEYVALKNEMARANNYEDYGDYWRGDYEEEWTGGYNYSRNQLIQDVEDTFEQIKPLYQHL
HAYVRAKLMDTYPSRISRTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNIDVTDAMVNQ
NWDARRIFKEAEKFFVSVGLPNMTQGFWENSMLTEPGDGRKVVCHPTAWDLGKGDFRIKM
CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPNHLKT
IGLLSPAFSEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGAIPKEQWMQKWWEM
KRNIVGVVEPVPHDETYCDPASLFHVANDYSFIRYYTRTIYQFQFQEALCQIAKHEGPLH
KCDISNSTEAGKKLLEMLSLGRSEPWTLALERVVGAKNMNVTPLLNYFEPLFTWLKEQNR
NSFVGWDTDWRPYSDQSIKVRISLKSALGEKAYEWNDNEMYLFRSSIAYAMREYFSKVKN
QTIPFVEDNVWVSDLKPRISFNFFVTFSNNVSDVIPRSEVEDAIRMSRSRINDAFRLDDN
SLEFLGIEPTLSPPYRPPVTIWLIVFGVVMGAIVVGIVLLIVSGIRNRRKNDQAGSEENP
YASVDLNKGENNPGFQHADDVQTSF
MSGSSWLLLSLVAVTTAQSTTEDEAKMFLDKFNTKAEDLSHQSSLASWDYNTNINDENVQK
MDEAGAKWSAFYEEQSKLAKNYSLEQIQNVTVKLQLQILQQSGSPVLSEDKSKRLNSILNA
MSTIYSTGKVCKPNKPQECLLLEPGLDNIMGTSKDYNERLWAWEGWRAEVGKQLRPLYEEY
VVLKNEMARGYHYEDYGDYWRRDYETEESPGPGYSRDQLMKDVERIFTEIKPLYEHLHAYV
RAKLMDTYPFHISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNIDVTDEMLKQGWDAD
RIFKEAEKFFVSVGLPNMTEGFWNNSMLTEPGDGRKVVCHPTAWDLGKGDFRIKMCTKVTM
EDFLTAHHEMGHIQYDMAYASQPYLLRNGANEGFHEAVGEVMSLSVATPKHLKTMGLLSPD
FREDNETEINFLLKQALNIVGTLPFTYMLEKWRWMVFKGEIPKEEWMKKWWEMKRKIVGVV
EPVPHDETYCDPASLFHVANDYSFIRYYTRTIFEFQFHEALCRIAQHDGPLHKCDISNSTD
AGKKLHQMLSVGKSQAWTKTLEDIVDSRNMDVGPLLKYFEPLYTWLQEQNRKSYVGWNTDW
SPYSDQSIKVRISLKSALGENAYEWNDNEMYLFRSSVAYAMREYFLKEKHQTILFGAENVW
VSNLKPRISFNFHVTSPGNLSDIIPRPEVEGAIRMSRSRINDAFRLDDNSLEFLGIQPTLG
PPYQPPVTIWLIVFGVVMAVVVVGIVVLIITGIRDRRKTDQARSEENPYSSVDLSKGENNP
GFQNGDDVQTSF
    • PIG/Sus scrofa: [4]
>tr|K7GLM4|K7GLM4_PIG Angiotensin-converting enzyme OS=Sus scrofa 
MSGSFWLLLSLIPVTAAQSTTEELAKTFLEKFNLEAEDLAYQSSLASWNYNTNITDENIQ
KMNDARAKWSAFYEEQSRIAKTYPLDEIQTLILKRQLQALQQSGTSGLSADKSKRLNTIL
NTMSTIYSSGKVLDPNNPQECLVLEPGLDEIMENSKDYSRRLWAWESWRAEVGKQLRPLY
EEYVVLENEMARANNYEDYGDYWRGDYEVTGTGDYDYSRNQLMEDVERTFAEIKPLYEHL
HAYVRAKLMDAYPSRISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGEKPSIDVTEAMVNQ
SWDAIRIFEEAEKFFVSIGLPNMTQGFWNNSMLTEPGDGRKVVCHPTAWDLGKGDFRIKM
CTKVTMDDFLTAHHEMGHIQYDMAYAIQPYLLRNGANEGFHEAVGEIMSLSAATPHYLKA
LGLLPPDFYEDSETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKEQWMQKWWEM
KREIVGVVEPLPHDETYCDPACLFHVAEDYSFIRYYTRTIYQFQFHEALCRTAKHEGPLY
KCDISNSTEAGQKLLQMLSLGKSEPWTLALENIVGVKTMDVKPLLSYFEPLLTWLKAQNG
NSSVGWNTDWTPYADQSIKVRISLKSALGKEAYEWNDNEMYLFRSSIAYAMRNYFSSAKN
ETIPFGAEDVWVSDLKPRISFNFFVTSPANMSDIIPRSDVEKAISMSRSRINDAFRLDDN
TLEFLGIQPTLGPPDEPPVTVWLIIFGVVMGLVVVGIVVLIFTGIRDRRKKKQASSEENP
YGSMDLSKGESNSGFQNGDDIQTSF
    • Chinese Pangolin/Manis pendactyla:[5]
>QLH93383.1 angiotensin I converting enzyme 2 [Manis pentadactyla]
MSGSSWLLLSLVAVTAAQSTSDEEAKTFLEKFNSEAEELSYQSSLASWNYNTNITDENVQK
MNVAGAKWSTFYEEQSKIAKNYQLQNIQNDTIKRQLQALQLSGSSALSADKNQRLNTILNT
MSTIYSTGKVCNPGNPQECSLLEPGLDNIMESSKDYNERLWAWEGWRSEVGKQLRPLYEEY
VVLKNEMARANHYEDYGDYWRGDYETEGANGYNYSRDHLIEDVEHIFTQIKPLYEHLHAYV
RAKLMDNYPSHISPTGCLPAHLLGDMWGRFWTNLYPLTVPFRQKPNIDVTDAMVNQTWDAN
RIFKEAEKFFVSVGLPKMTQTFWENSMLTEPGDGRKVVHPTAWDLGKHDFRIKMCTKVTMD
DFLTAHHEMGHIQYDMAYAMQPYLLRNGANEGFHEAVGEIMSLSAATPKHLKNIGLLPPDF
YEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFSGQIPKEQWMKKWWEMKREIVGVVE
PVPHDETYCDPASLFHVANDYSFIRYYTRTIYQFQFQEALCQTAKHEGPLHKCDISNSTEA
GQKLLQMLSLGKSKPWTLALERVVGTKNMDVRPLLNYFEPLLTWLKEQNKNSFVGWNTDWS
PYAAQSIKVRISLKSALGEKAYEWNDSEMYLFRSSVAYAMREYFSKFKKQTIPFEEESVRV
SDLKPRVSFIFFVTLPKNVSAVIPRAEVEEAIRMSRSRINDVFRLDDNSLEFLGIQPTLEP
PYQPPVTIWLIVFGVVMGVIVVGIVVLIFTGIRDRKKKNQARSEQNPYASVDLSKGENNPG
FQNVDDVQTSF
>sp|Q5RFN1.1|ACE2_PONAB RecName: Full=Angiotensin-converting enzyme 2 
MSGSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNM
NNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMS
TIYSTGKVCNPNNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVL
KNEMARANHYEDYGDYWRGDYEVNGVDSYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKL
INAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKE
AEKFFVSVGLPNMTQRFWENSMLTDPGNVQKVVCHPTAWDLGKGDFRILMCTKVTMDDFLTA
HHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNET
EINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDET
YCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLLNML
RLGKSEPWTLALENVVGAKNMNVRPLLDYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKV
RISLKSALGNKAYEWNDNEIYLFRSSVAYAMRKYFLEVKNQMILFGEEDVRVANLKPRISFN
FFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLI
VFGVVMGVIVVGIVVLIFTGIRDRKKKNKARNEENPYASIDISKGENNPGFQNTDDVQTSF
>sp|Q5RFN1.1|ACE2_PONAB RecName: Full=Angiotensin-converting enzyme 2
MSGSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMN
NAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTI
YSTGKVCNPNNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNE
MARANHYEDYGDYWRGDYEVNGVDSYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLINAY 
PSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFF
VSVGLPNMTQRFWENSMLTDPGNVQKVVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHI
QYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQA
LTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVS
NDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLLNMLRLGKSEPWTLALE
NVVGAKNMNVRPLLDYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGNKAYEW
NDNEIYLFRSSVAYAMRKYFLEVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTE
VEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVVLIFT
GIRDRKKKNKARNEENPYASIDISKGENNPGFQNTDDVQTSF
>sp|Q5RFN1.1|ACE2_PONAB RecName: Full=Angiotensin-converting enzyme 2
MSGSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNA
GDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTG
KVCNPNNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANH
YEDYGDYWRGDYEVNGVDSYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLINAYPSYISPIG
CLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQ
RFWENSMLTDPGNVQKVVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPF
LLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYML
EKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQ
FQFQEALCQAAKHEGPLHKCDISNSTEAGQKLLNMLRLGKSEPWTLALENVVGAKNMNVRPLLDYF
EPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGNKAYEWNDNEIYLFRSSVAYAMRKY  
FLEVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN
SLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVVLIFTGIRDRKKKNKARNEENPYASIDI
SKGENNPGFQNTDDVQTSF
>AAY57872.1 angiotensin converting enzyme 2 [Chlorocebus aethiops]
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAG
EKWSAFLKEQSTLAQMYPLQAIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIHSTGKV
CNPNNPQECLLLDPGLNEIMEKSLDYNERLWAWEGWRSEVGKQLRPLYEEYVVLKNEMARANHYKD
YGDYWRGDYEVNGVDGYDYNRDQLIEDVERTFEEIKPLYEHLHAYVRAKLMNAYPSYISPTGCLPA
HLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVNQAWNAQRIFKEAEKFFVSVGLPNMTQGFWEN
SMLTDPGNVQKVVCHPTAWDLGKGDFRIIMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGA
NEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWM
VFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEA
LCQAAKHEGPLHKCDISNSTEAGQKLLNMLKLGKSEPWTLALENVVGAKNMSVRPLLNYFEPLFTW
LKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGANAYKWNDNEMYLFRSSVAYAMRQYFLENKH
QTILFGEEDVRVADLKPRISFNFYVTAPKNVSDIIPRTEVEEAIRFSRSRINDAFQLNDNSLEFLG
IQSTLVPPYQSPITTWLIVFGVVMAVIVAGIVVLIFTGIRDRKKKNQARSEENPYASIDISKGENN
PGFQNTDDVQTSF
>sp|Q5RFN1.1|ACE2_PONAB RecName: Full=Angiotensin-converting
enzyme 2
MSGSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAG
DKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKV
CNPNNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYED
YGDYWRGDYEVNGVDSYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLINAYPSYISPIGCLPA
HLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQRFWEN
SMLTDPGNVQKVVCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGA
NEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWM
VFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEAL
CQAAKHEGPLHKCDISNSTEAGQKLLNMLRLGKSEPWTLALENVVGAKNMNVRPLLDYFEPLFTWLK
DQNKNSFVGWSTDWSPYADQSIKVRISLKSALGNKAYEWNDNEIYLFRSSVAYAMRKYFLEVKNQMI
LFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPT
LGPPNQPPVSIWLIVFGVVMGVIVVGIVVLIFTGIRDRKKKNKARNEENPYASIDISKGENNPGFQN
TDDVQTSF

Multiple Sequence Alignment

  • Used www.phylogeny.frto do a phylogeny analysis on the sequences from the talk page.
    • Clicked on Phylogeny Analysis
    • Clicked on One Click Mode
    • Copied and Pasted the talk page spike sequences
    • Clicked Submit
    • Clicked on tab 3.Alignment and under output reformatted sequence into Alignment in Clustal Format
sp|Q8R0I0|      MSSSSWLLLSLVAVTTAQSLTEENAKTFLNNFNQEAEDLSYQSSLASWNYNTNITEENAQ
sp|Q5EGZ1|      MSSSCWLLLSLVAVATAQSLIEEKAESFLNKFNQEAEDLSYQSSLASWNYNTNITEENAQ
tr|U5WHY8|      MSGSSWLLLSLVAVTTAQSTTEDEAKMFLDKFNTKAEDLSHQSSLASWDYNTNINDENVQ
AGZ48803.1      MSGSSWLLLSLVAVTTAQSTTEDEAKMFLDKFNTKAEDLSHQSSLASWDYNTNINDENVQ
tr|K7GLM4|      MSGSFWLLLSLIPVTAAQSTTEELAKTFLEKFNLEAEDLAYQSSLASWNYNTNITDENIQ
AAY57872.1      MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ
sp|Q9BYF1|      MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ
Q5RFN1.1_P      MSGSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ
QLH933_b        MSGSSWLLLSLVAVTAAQSTSDEEAKTFLEKFNSEAEELSYQSSLASWNYNTNITDENVQ
QLH933_a        MSGSSWLLLSLVAVTAAQSTSDEEAKTFLEKFNSEAEELSYQSSLASWNYNTNITDENVQ
NP_0011587      MSGSSWLLLSLAALTAAQST-EDLVKTFLEKFNYEAEELSYQSSLASWNYNINITDENVQ
sp|Q56NL1|      MSGSFWLLLSFAALTAAQSTTEELAKTFLETFNYEAQELSYQSSVASWNYNTNITDENAK
NP_0010345      MSGSFWLLLSFAALTAAQSTTEELAKTFLEKFNHEAEELSYQSSLASWNYNTNITDENVQ
                **.* *****: .:::***  :: .: **:.** :*::* :***:***:** **.:** :
sp|Q8R0I0|      KMSEAAAKWSAFYEEQSKTAQSFSLQEIQTPIIKRQLQALQQSGSSALSADKNKQLNTIL
sp|Q5EGZ1|      KMNEAAAKWSAFYEEQSKIAQNFSLQEIQNATIKRQLKALQQSGSSALSPDKNKQLNTIL
tr|U5WHY8|      KMDEAGAKWSAFYEEQSKLAKNYSLEQIQNVTVKLQLQILQQSGSPVLSEDKSKRLNSIL
AGZ48803.1      KMDEAGAKWSAFYEEQSKLAKNYSLEQIQNVTVKLQLQILQQSGSPVLSEDKSKRLNSIL
tr|K7GLM4|      KMNDARAKWSAFYEEQSRIAKTYPLDEIQTLILKRQLQALQQSGTSGLSADKSKRLNTIL
AAY57872.1      NMNNAGEKWSAFLKEQSTLAQMYPLQAIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL
sp|Q9BYF1|      NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL
Q5RFN1.1_P      NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL
QLH933_b        KMNVAGAKWSTFYEEQSKIAKNYQLQNIQNDTIKRQLQALQLSGSSALSADKNQRLNTIL
QLH933_a        KMNVAGAKWSTFYEEQSKIAKNYQLQNIQNDTIKRQLQALQLSGSSALSADKNQRLNTIL
NP_0011587      KMNNAGAKWSAFYEEQSKLAKTYPLEEIQDSTVKRQLRALQHSGSSVLSADKNQRLNTIL
sp|Q56NL1|      NMNEAGAKWSAYYEEQSKLAQTYPLAEIQDAKIKRQLQALQQSGSSVLSADKSQRLNTIL
NP_0010345      KMNEAGAKWSAFYEEQSKLAKTYPLAEIHNTTVKRQLQALQQSGSSVLSADKSQRLNTIL
                :*. *  ***:: :***  *: : *  *:   :* **. ** .*:. ** **.:.**:**
sp|Q8R0I0|      NTMSTIYSTGKVCNPKNPQECLLLEPGLDEIMATSTDYNSRLWAWEGWRAEVGKQLRPLY
sp|Q5EGZ1|      NTMSTIYSTGKVCNSMNPQECFLLEPGLDEIMATSTDYNRRLWAWEGWRAEVGKQLRPLY
tr|U5WHY8|      NAMSTIYSTGKVCKPNKPQECLLLEPGLDNIMGTSKDYNERLWAWEGWRAEVGKQLRPLY
AGZ48803.1      NAMSTIYSTGKVCKPNKPQECLLLEPGLDNIMGTSKDYNERLWAWEGWRAEVGKQLRPLY
tr|K7GLM4|      NTMSTIYSSGKVLDPNNPQECLVLEPGLDEIMENSKDYSRRLWAWESWRAEVGKQLRPLY
AAY57872.1      NTMSTIHSTGKVCNPNNPQECLLLDPGLNEIMEKSLDYNERLWAWEGWRSEVGKQLRPLY
sp|Q9BYF1|      NTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY
Q5RFN1.1_P      NTMSTIYSTGKVCNPNNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY
QLH933_b        NTMSTIYSTGKVCNPGNPQECSLLEPGLDNIMESSKDYNERLWAWEGWRSEVGKQLRPLY
QLH933_a        NTMSTIYSTGKVCNPGNPQECSLLEPGLDNIMESSKDYNERLWAWEGWRSEVGKQLRPLY
NP_0011587      NSMSTVYSTGKACNPSNPQECLLLEPGLDDIMENSKDYNERLWAWEGWRSEVGKQLRPLY
sp|Q56NL1|      NAMSTIYSTGKACNPNNPQECLLLEPGLDNIMENSKDYNERLWAWEGWRAEVGKQLRPLY
NP_0010345      NAMSTIYSTGKACNPNNPQECLLLEPGLDDIMENSKDYNERLWAWEGWRAEVGKQLRPLY
                *:***::*:**. .. :**** :*:***::** .* **. ******.**:**********
sp|Q8R0I0|      EEYVVLKNEMARANNYNDYGDYWRGDYEAEGADGYNYNRNQLIEDVERTFAEIKPLYEHL
sp|Q5EGZ1|      EEYVVLKNEMARANNYEDYGDYWRGDYEAEGVEGYNYNRNQLIEDVENTFKEIKPLYEQL
tr|U5WHY8|      EEYVVLKNEMARGYHYEDYGDYWRRDYETEESPGPGYSRDQLMKDVERIFTEIKPLYEHL
AGZ48803.1      EEYVVLKNEMARGYHYEDYGDYWRRDYETEESPGPGYSRDQLMKDVERIFTEIKPLYEHL
tr|K7GLM4|      EEYVVLENEMARANNYEDYGDYWRGDYEVTGTGDYDYSRNQLMEDVERTFAEIKPLYEHL
AAY57872.1      EEYVVLKNEMARANHYKDYGDYWRGDYEVNGVDGYDYNRDQLIEDVERTFEEIKPLYEHL
sp|Q9BYF1|      EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHL
Q5RFN1.1_P      EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDSYDYSRGQLIEDVEHTFEEIKPLYEHL
QLH933_b        EEYVVLKNEMARANHYEDYGDYWRGDYETEGANGYNYSRDHLIEDVEHIFTQIKPLYEHL
QLH933_a        EEYVVLKNEMARANHYEDYGDYWRGDYETEGANGYNYSRDHLIEDVEHIFTQIKPLYEHL
NP_0011587      EEYVALKNEMARANNYEDYGDYWRGDYEEEWENGYNYSRNQLIDDVELTFTQIMPLYQHL
sp|Q56NL1|      EEYVALKNEMARANNYEDYGDYWRGDYEEEWTGGYNYSRNQLIQDVEDTFEQIKPLYQHL
NP_0010345      EEYVALKNEMARANNYEDYGDYWRGDYEEEWTDGYNYSRSQLIKDVEHTFTQIKPLYQHL
                ****.*:*****. :*:******* ***     . .*.*.:*:.***  * :* ***::*
sp|Q8R0I0|      HAYVRRKLMDTYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTVPFAQKPNIDVTDAMMNQ
sp|Q5EGZ1|      HAYVRTKLMEVYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTTPFLQKPNIDVTDAMVNQ
tr|U5WHY8|      HAYVRAKLMDTYPFHISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNIDVTDEMLKQ
AGZ48803.1      HAYVRAKLMDTYPFHISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNIDVTDEMLKQ
tr|K7GLM4|      HAYVRAKLMDAYPSRISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGEKPSIDVTEAMVNQ
AAY57872.1      HAYVRAKLMNAYPSYISPTGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVNQ
sp|Q9BYF1|      HAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
Q5RFN1.1_P      HAYVRAKLINAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
QLH933_b        HAYVRAKLMDNYPSHISPTGCLPAHLLGDMWGRFWTNLYPLTVPFRQKPNIDVTDAMVNQ
QLH933_a        HAYVRAKLMDNYPSHISPTGCLPAHLLGDMWGRFWTNLYPLTVPFRQKPNIDVTDAMVNQ
NP_0011587      HAYVRTKLMDTYPSYISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNIDVTNAMVNQ
sp|Q56NL1|      HAYVRAKLMDTYPSRISRTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNIDVTDAMVNQ
NP_0010345      HAYVRAKLMDTYPSRISPTGCLPAHLLGDMWGRFWTNLYPLTVPFGQKPNIDVTDAMVNQ
                ***** **:: **  **  ********************.**.** :**.****: *:.*
sp|Q8R0I0|      GWDAERIFQEAEKFFVSVGLPHMTQGFWANSMLTEPADGRKVVCHPTAWDLGHGDFRIKM
sp|Q5EGZ1|      SWDAERIFKEAEKFFVSVGLPQMTPGFWTNSMLTEPGDDRKVVCHPTAWDLGHGDFRIKM
tr|U5WHY8|      GWDADRIFKEAEKFFVSVGLPNMTEGFWNNSMLTEPGDGRKVVCHPTAWDLGKGDFRIKM
AGZ48803.1      GWDADRIFKEAEKFFVSVGLPNMTEGFWNNSMLTEPGDGRKVVCHPTAWDLGKGDFRIKM
tr|K7GLM4|      SWDAIRIFEEAEKFFVSIGLPNMTQGFWNNSMLTEPGDGRKVVCHPTAWDLGKGDFRIKM
AAY57872.1      AWNAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKVVCHPTAWDLGKGDFRIIM
sp|Q9BYF1|      AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM
Q5RFN1.1_P      AWDAQRIFKEAEKFFVSVGLPNMTQRFWENSMLTDPGNVQKVVCHPTAWDLGKGDFRILM 
QLH933_b        TWDANRIFKEAEKFFVSVGLPKMTQTFWENSMLTEPGDGRKVV-HPTAWDLGKHDFRIKM
QLH933_a        TWDANRIFKEAEKFFVSVGLPKMTQTFWENSMLTEPGDGRKVVCHPTAWDLGKHDFRIKM
NP_0011587      SWDARKIFKEAEKFFVSVGLPNMTQEFWGNSMLTEPSDSRKVVCHPTAWDLGKGDFRIKM
sp|Q56NL1|      NWDARRIFKEAEKFFVSVGLPNMTQGFWENSMLTEPGDGRKVVCHPTAWDLGKGDFRIKM
NP_0010345      SWDARRIFKEAEKFFVSVGLPNMTQGFWENSMLTEPGDSRKVVCHPTAWDLGKGDFRIKM
                 *:* .**:********:***:**  ** *****:*.: .*.* ********: **** *
sp|Q8R0I0|      CTKVTMDNFLTAHHEMGHIQYDMAYARQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
sp|Q5EGZ1|      CTKVTMDNFLTAHHEMGHIQYDMAYAKQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
tr|U5WHY8|      CTKVTMEDFLTAHHEMGHIQYDMAYASQPYLLRNGANEGFHEAVGEVMSLSVATPKHLKT
AGZ48803.1      CTKVTMEDFLTAHHEMGHIQYDMAYASQPYLLRNGANEGFHEAVGEVMSLSVATPKHLKT
tr|K7GLM4|      CTKVTMDDFLTAHHEMGHIQYDMAYAIQPYLLRNGANEGFHEAVGEIMSLSAATPHYLKA
AAY57872.1      CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
sp|Q9BYF1|      CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
Q5RFN1.1_P      CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
QLH933_b        CTKVTMDDFLTAHHEMGHIQYDMAYAMQPYLLRNGANEGFHEAVGEIMSLSAATPKHLKN
QLH933_a        CTKVTMDDFLTAHHEMGHIQYDMAYAMQPYLLRNGANEGFHEAVGEIMSLSAATPKHLKN
NP_0011587      CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPNHLKN
sp|Q56NL1|      CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPNHLKT
NP_0010345      CTKVTMDDFLTAHHEMGHIQYDMAYAVQPFLLRNGANEGFHEAVGEIMSLSAATPNHLKT
                ******::****************** **:****************:****.***::** 
sp|Q8R0I0|      IGLLPSDFQEDSETEINFLLKQALTIVGTLPFTYMLEKWRWMVFRGEIPKEQWMKKWWEM
sp|Q5EGZ1|      IGLLPSNFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFQDKIPREQWTKKWWEM
tr|U5WHY8|      MGLLSPDFREDNETEINFLLKQALNIVGTLPFTYMLEKWRWMVFKGEIPKEEWMKKWWEM
AGZ48803.1      MGLLSPDFREDNETEINFLLKQALNIVGTLPFTYMLEKWRWMVFKGEIPKEEWMKKWWEM
tr|K7GLM4|      LGLLPPDFYEDSETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKEQWMQKWWEM
AAY57872.1      IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM
sp|Q9BYF1|      IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM
Q5RFN1.1_P      IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM
QLH933_b        IGLLPPDFYEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFSGQIPKEQWMKKWWEM
QLH933_a        IGLLPPDFYEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFSGQIPKEQWMKKWWEM
NP_0011587      IGLLPPSFFEDSETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKTWWEM
sp|Q56NL1|      IGLLSPAFSEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGAIPKEQWMQKWWEM
NP_0010345      IGLLSPGFSEDSETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKEQWMQKWWEM
                :***.. * **.************.******************* . **.::* :.****
sp|Q8R0I0|      KREIVGVVEPLPHDETYCDPASLFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKYNGSLH
sp|Q5EGZ1|      KREIVGVVEPLPHDETYCDPASLFHVSNDYSFIRYYTRTIYQFQFQEALCQAAKHDGPLH
tr|U5WHY8|      KRKIVGVVEPVPHDETYCDPASLFHVANDYSFIRYYTRTIFEFQFHEALCRIAQHDGPLH
AGZ48803.1      KRKIVGVVEPVPHDETYCDPASLFHVANDYSFIRYYTRTIFEFQFHEALCRIAQHDGPLH
tr|K7GLM4|      KREIVGVVEPLPHDETYCDPACLFHVAEDYSFIRYYTRTIYQFQFHEALCRTAKHEGPLY
AAY57872.1      KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH
sp|Q9BYF1|      KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH
Q5RFN1.1_P      KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH
QLH933_b        KREIVGVVEPVPHDETYCDPASLFHVANDYSFIRYYTRTIYQFQFQEALCQTAKHEGPLH
QLH933_a        KREIVGVVEPVPHDETYCDPASLFHVANDYSFIRYYTRTIYQFQFQEALCQTAKHEGPLH
NP_0011587      KRNIVGVVEPVPHDETYCDPASLFHVANDYSFIRYYTRTIYQFQFQEALCQIAKHEGPLH
sp|Q56NL1|      KRNIVGVVEPVPHDETYCDPASLFHVANDYSFIRYYTRTIYQFQFQEALCQIAKHEGPLH
NP_0010345      KREIVGVVEPVPHDETYCDPASLFHVANDYSFIRYYTRTIYQFQFQEALCRIAKHEGPLH
                **:*******:**********.****::***********:::***:****. *:::*.*:
sp|Q8R0I0|      KCDISNSTEAGQKLLKMLSLGNSEPWTKALENVVGARNMDVKPLLNYFQPLFDWLKEQNR
sp|Q5EGZ1|      KCDISNSTEAGQKLLNMLSLGNSGPWTLALENVVGSRNMDVKPLLNYFQPLFVWLKEQNR
tr|U5WHY8|      KCDISNSTDAGKKLHQMLSVGKSQAWTKTLEDIVDSRNMDVGPLLKYFEPLYTWLQEQNR
AGZ48803.1      KCDISNSTDAGKKLHQMLSVGKSQAWTKTLEDIVDSRNMDVGPLLKYFEPLYTWLQEQNR
tr|K7GLM4|      KCDISNSTEAGQKLLQMLSLGKSEPWTLALENIVGVKTMDVKPLLSYFEPLLTWLKAQNG
AAY57872.1      KCDISNSTEAGQKLLNMLKLGKSEPWTLALENVVGAKNMSVRPLLNYFEPLFTWLKDQNK
sp|Q9BYF1|      KCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
Q5RFN1.1_P      KCDISNSTEAGQKLLNMLRLGKSEPWTLALENVVGAKNMNVRPLLDYFEPLFTWLKDQNK
QLH933_b        KCDISNSTEAGQKLLQMLSLGKSKPWTLALERVVGTKNMDVRPLLNYFEPLLTWLKEQNK
QLH933_a        KCDISNSTEAGQKLLQMLSLGKSKPWTLALERVVGTKNMDVRPLLNYFEPLLTWLKEQNK
NP_0011587      KCDISNSSEAGQKLLEMLKLGKSKPWTYALEIVVGAKNMDVRPLLNYFEPLFTWLKEQNR
sp|Q56NL1|      KCDISNSTEAGKKLLEMLSLGRSEPWTLALERVVGAKNMNVTPLLNYFEPLFTWLKEQNR
NP_0010345      KCDISNSSEAGKKLLQMLTLGKSKPWTLALEHVVGEKKMNVTPLLKYFEPLFTWLKEQNR
                *******::**:** :** :*.* .** :** :*. ..*.* ***.**:**  **: ** 
sp|Q8R0I0|      NSFVGWNTEWSPYADQSIKVRISLKSALGANAYEWTNNEMFLFRSSVAYAMRKYFSIIKN
sp|Q5EGZ1|      NSTVGWSTDWSPYADQSIKVRISLKSALGKNAYEWTDNEMYLFRSSVAYAMREYFSREKN
tr|U5WHY8|      KSYVGWNTDWSPYSDQSIKVRISLKSALGENAYEWNDNEMYLFRSSVAYAMREYFLKEKH
AGZ48803.1      KSYVGWNTDWSPYSDQSIKVRISLKSALGENAYEWNDNEMYLFRSSVAYAMREYFLKEKH
tr|K7GLM4|      NSSVGWNTDWTPYADQSIKVRISLKSALGKEAYEWNDNEMYLFRSSIAYAMRNYFSSAKN
AAY57872.1      NSFVGWSTDWSPYADQSIKVRISLKSALGANAYKWNDNEMYLFRSSVAYAMRQYFLENKH
sp|Q9BYF1|      NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKN
Q5RFN1.1_P      NSFVGWSTDWSPYADQSIKVRISLKSALGNKAYEWNDNEIYLFRSSVAYAMRKYFLEVKN
QLH933_b        NSFVGWNTDWSPYAAQSIKVRISLKSALGEKAYEWNDSEMYLFRSSVAYAMREYFSKFKK
QLH933_a        NSFVGWNTDWSPYAAQSIKVRISLKSALGEKAYEWNDSEMYLFRSSVAYAMREYFSKFKK
NP_0011587      NSFVGWNTDWSPYADQSIKVRISLKSALGEKAYEWNNNEMYLFRSSIAYAMRQYFSEVKN
sp|Q56NL1|      NSFVGWDTDWRPYSDQSIKVRISLKSALGEKAYEWNDNEMYLFRSSIAYAMREYFSKVKN
NP_0010345      NSFVGWNTDWRPYADQSIKVRISLKSALGDEAYEWNDNEMYLFRSSVAYAMREYFSKVKN
               :* ***.*:* **: ************** :**:*.:.*::*****:*****:**   *:
sp|Q8R0I0|      QTVPFLEEDVRVSDLKPRVSFYFFVTSPQNVSDVIPRSEVEDAIRMSRGRINDVFGLNDN
sp|Q5EGZ1|      QTVPFGEADVWVSDLKPRVSFNFFVTSPKNVSDIIPRSEVEEAIRMSRGRINDIFGLNDN
tr|U5WHY8|      QTILFGAENVWVSNLKPRISFNFHVTSPGNLSDIIPRPEVEGAIRMSRSRINDAFRLDDN
AGZ48803.1      QTILFGAENVWVSNLKPRISFNFHVTSPGNLSDIIPRPEVEGAIRMSRSRINDAFRLDDN
tr|K7GLM4|      ETIPFGAEDVWVSDLKPRISFNFFVTSPANMSDIIPRSDVEKAISMSRSRINDAFRLDDN
AAY57872.1      QTILFGEEDVRVADLKPRISFNFYVTAPKNVSDIIPRTEVEEAIRFSRSRINDAFQLNDN
sp|Q9BYF1|      QMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN
Q5RFN1.1_P      QMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN
QLH933_b        QTIPFEEESVRVSDLKPRVSFIFFVTLPKNVSAVIPRAEVEEAIRMSRSRINDVFRLDDN
QLH933_a        QTIPFEEESVRVSDLKPRVSFIFFVTLPKNVSAVIPRAEVEEAIRMSRSRINDVFRLDDN
NP_0011587      QTIPFVEDNVWVSDLKPRISFNFSVTSPGNVSDIIPRTEVEEAIRMYRSRINDVFRLDDN
sp|Q56NL1|      QTIPFVEDNVWVSDLKPRISFNFFVTFSNNVSDVIPRSEVEDAIRMSRSRINDAFRLDDN
NP_0010345      QTIPFVEDNVWVSNLKPRISFNFFVTASKNVSDVIPRSEVEEAIRMSRSRINDAFRLDDN
                : : *   .*.*::****:** * ** . *:* :***.:** ** : *.**** * *:**
sp|Q8R0I0|      SLEFLGIHPTLEPPYQPPVTIWLIIFGVVMALVVVGIIILIVTGIKGRKKKNETKREENP 
sp|Q5EGZ1|      SLEFLGIYPTLKPPYEPPVTIWLIIFGVVMGTVVVGIVILIVTGIKGRKKKNETKREENP
tr|U5WHY8|      SLEFLGIQPTLGPPYQPPVTIWLIVFGVVMAVVVVGIVVLIITGIRDRRKTDQARSEENP
AGZ48803.1      SLEFLGIQPTLGPPYQPPVTIWLIVFGVVMAVVVVGIVVLIITGIRDRRKTDQARSEENP
tr|K7GLM4|      TLEFLGIQPTLGPPDEPPVTVWLIIFGVVMGLVVVGIVVLIFTGIRDRRKKKQASSEENP
AAY57872.1      SLEFLGIQSTLVPPYQSPITTWLIVFGVVMAVIVAGIVVLIFTGIRDRKKKNQARSEENP
sp|Q9BYF1|      SLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENP
Q5RFN1.1_P      SLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVVLIFTGIRDRKKKNKARNEENP
QLH933_b        SLEFLGIQPTLEPPYQPPVTIWLIVFGVVMGVIVVGIVVLIFTGIRDRKKKNQARSEQNP
QLH933_a        SLEFLGIQPTLEPPYQPPVTIWLIVFGVVMGVIVVGIVVLIFTGIRDRKKKNQARSEQNP
NP_0011587      SLEFLGIQPTPGPPYEPPVTIWLIVFGVVMGVVVVGIVLLIFSGIRNRRKNDQARGEENP
sp|Q56NL1|      SLEFLGIEPTLSPPYRPPVTIWLIVFGVVMGAIVVGIVLLIVSGIRNRRKNDQAGSEENP
NP_0010345      SLEFLGIQPTLSPPYQPPVTIWLIVFGVVMGVVVVGIVLLIVSGIRNRRKNNQARSEENP
                :****** .*  **  .*:: ***:*****. :*.**::**.:**..*.*..::   :**
sp|Q8R0I0|      YDSMDIGKGESNAGFQNSDDAQTSF
sp|Q5EGZ1|      YDSMDIGKGESNAGFQNSDDAQTSF
tr|U5WHY8|      YSSVDLSKGENNPGFQNGDDVQTSF
AGZ48803.1      YSSVDLSKGENNPGFQNGDDVQTSF
tr|K7GLM4|      YGSMDLSKGESNSGFQNGDDIQTSF
AAY57872.1      YASIDISKGENNPGFQNTDDVQTSF
sp|Q9BYF1|      YASIDISKGENNPGFQNTDDVQTSF
Q5RFN1.1_P      YASIDISKGENNPGFQNTDDVQTSF
QLH933_b        YASVDLSKGENNPGFQNVDDVQTSF
QLH933_a        YASVDLSKGENNPGFQNVDDVQTSF
NP_0011587      YASVDLSKGENNPGFQSGDDVQTSF
sp|Q56NL1|      YASVDLNKGENNPGFQHADDVQTSF
NP_0010345      YASVDLSKGENNPGFQHADDVQTSF
                * *:*:.***.*.***  ** ****

Phylogenetic Tree

  • Clicked on tab 6.Tree Rendering so the data is reformatted as a phylogenetic tree

Nidapatel lab 6 phylo tree.png

Protein Structures

MakelaHBondsHumanSARSCoV.png
MakelaSARSCoVCivetwithACE2.png
Makela2019nCoVHuman.png

Scientific Conclusion

  • This assignment served as a way to test whether COVID-19 transmission from human host to 11 other species is possible based on their individual ACE2 sequences - this was doing by using the UniProt and Genbank Database the ACE2 sequences of 12 species including humans, mice, pangolins, civets, ferrets, bats, rats, monkeys, orangutans, cats, dogs, and pigs and were compared to see if species to species transmission is possible.
  • Based on the information shown in our phylogenetic tree, we would assume that the orangutans and monkeys (shown in the same clade towards the top of the figure) should have the ACE2 sequences that are most similar to the human ACE2 receptor.
  • When comparing the protein structures of the human SARS-CoV protein and the civet SARS-CoV protein (optimized for human ACE2 recognition), we noticed when looking at the specific hotspot amino acids within both proteins, that they had the same sequences other than in hotspots 31 and 353.
    • This further supports the data presented in the Wan et. al paper that rats and mice are unlikely hosts for SARS-CoV, and our results indicate those differences based on their amino acids in hotspot locations 31 and 353.

Acknowledgments

  • I acknowledge my homework partner Nida Patel, who I consulted for several hours regarding syntax, formatting, and content questions. I also copied and modified the formatting and syntax from Nida Patel Journal Week 6.
  • I acknowledge that I copied and modified the protocol shown on the Week 6 assignment page for this course.

Except for what is noted above, this individual entry was completed by me and not copied from another source. Taylor Makela (talk)

References

Template Links

Assignment Pages

Individual Journal Pages

Class Journal Pages