Antibody:PTBP2 AV40965 Sigma

From OpenWetWare
Jump to navigationJump to search
                       
List of OpenWetWare Antibodies
Antibody cartoon 40x41transp.png
anti PTBP2 AV40965 Sigma
Antibody transparentbg.png
Antibody Type  unknown species polyclonal IgG
Target UniProt ID  Q9UKA9
Cross-Reactive w  human
Not Cross-Reactive w  unknown
Raised Against  peptide
Provider  Sigma
Suitability for..
Western Blot  untested
Immunoprecipitation  untested
Staining fixed cells   untested
Staining cryo-sections  untested
Staining paraffin sections  untested
Help

Description

  • raised against N-terminal peptide of human PTBP2
  • 1 difference to mouse PTBP2 in the same region
human           MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRV 60
sigma           -DGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGED--------- 50
mouse           MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRV 60
                 ********************************.*****************         

Warning

  • no species information given on web site
  • WB shown on page shows protein band of the wrong size

Link to manufacturer

(doesn't work in infobox; due to the | character?)