Sap Protein Sequence

From OpenWetWare
Jump to: navigation, search

MAKTNSYKKVIAGTMTAAMVAGVVSPVAAAGKTFPDVPADHWGIDSINYLVEKGAVKGNDKGMFEPGKEL TRAEAATMMAQILNLPIDKDAKPSFADSQGQWYTPFIAAVEKAGVIKGTGNGFEPNGKIDRVSMASLLVE AYKLDTKVNGTPATKFKDLETLNWGKEKANILVELGISVGTGDQWEPKKTVTKAEAAQFIAKTDKQFGTE AAKVESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTY TVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGE ITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAEGAAVASISNWTVAEQNKADFTSKDFKQNNKVYEGDNA YVQVELKDQFNAVTTGKVEYESLNTEVAVVDKATGKVTVLSAGKAPVKVTVKDSKGKELVSKTVEIEAFA QKAMKEIKLEKTNVALSTKDVTDLKVKAPVLDQYGKEFTAPVTVKVLDKDGKELKEQKLEAKYVNKELVL NAAGQEAGNYTVVLTAKSGEKEAKATLALELKAPGAFSKFEVRGLEKELDKYVTEENQKNAMTVSVLPVD ANGLVLKGAEAAELKVTTTNKEGKEVDATDAQVTVQNNSVITVGQGAKAGETYKVTVVLDGKLITTHSFK VVDTAPTAKGLAVEFTSTSLKEVAPNADLKAALLNILSVDGVPATTAKATVSNVEFVSADTNVVAENGTV GAKGATSIYVKNLTVVKDGKEQKVEFDKAVQVAVSIKEAKPATK