Matt Gethers/CRI, Thailand/Specifications/Specs for HmgR

From OpenWetWare
Jump to: navigation, search

Specs for HmgR

Protein Sequence:meknsspaetsgkqkvrsaevgtdilkalaelspatslsrla

ehvgmpaskvhrylqaliasgfavqdastnhyslgrealrvglaaldsmdvlksaaapl

aelrdvlnetcflavwgnrgatvvqveqavravtvvtqvgsvlpllgsstglvfaaflp

erevaelreeelagradhpladpaayavllegirarglhaihgllmpgvealsapvfda

rgrvaavltvvgpasifqaeeqgpaaerllattraiswrmgydgtqgg*

Length: 267 aa

Theoretical pI: 5.73

Theoretical Mw: 27979.98 Da

Binding Box:

KEGG File for HmgR (pa2010)

Potential HmgR Mutant

For the potential mutant HmgR with a single base insertion at 5672 on the pIs001 vector NTI annotation:

Protein Sequence: meknsspaetsgkqkvrsaevgtdilkalaelspatslsrla

ehvgmpaskvhrylqaliasgfavqdastnhyslgrealrvglaaldsmdvlksaaapla

elrdvlnetcflavwgepwrhrgtggtggargdgghpgrlgaaaarfvhrpgvrrvpagt

rggraargrvgracrpsagrpgglrgapgghprarpacdpwaadawgggalgtgvrrpra

ggggahggrpgehlpgrgagasggtaacddsgyqladgv*

Length: 262 aa

Theoretical pI: 10.73

Theoretical Mw: 26384.60 Da

Mw very close to correct protein. I wouldn't be able to tell them apart on a gel. Perhaps I could do a pH gradient gel for the isoelectric point.


Notes on 7.15.08 Isolation/Purification Product

Concentration: 2.545 g/L or ~90.5 μM