IGEM:IMPERIAL/2008/Bioprinter/Subteam 3

From OpenWetWare
Jump to navigationJump to search

Biomaterials

We aim to synthesize two types of biomaterials, elastin and EAK16-II 3D scaffolds.

Elastin

Construct EP20-24-24 for human elastin polypeptide
Hydrophobic interactions and cross-linkages between adjacent EP chains

Elastin is a polymeric extracellular matrix protein found in tissues that require the abitlity ot extend as well as posses elastic recoil. Examples of elastin containing tissues include arteries, lungs, ligaments and skin. The precursor for elastin is a soluble protein called tropoelastin, consisting of alternating hydrophobic regions and crosslinking domains with distinct exons coding each domain.

The hydrophobic domains are rich in glycine, valine, proline and other non-polar amino acids, often in tandem polypeptide repeats. Crosslinking domains are rich in alanine and contain lysine residues, which form covalent crosslinks that stabilise the polymeric form of elastin.

Under appropriate conditions of temperature and ionic strength, elastin undergoes a self-aggregation process called coacervation. This is where the protein separates from the solution as a second phase and is usually induced by an increase in temperature.

Unlike most proteins, which undergo denaturation when the temperature of the solution increases, elastin polypeptides become more ordered through coacervation. The temperature at which coacervation occurs is dependent on the relative proportions of hydrophobic and hydrophilic residues in the synthetic polypeptides as well as the ionic strength, pH and protein concentration of the solution.


Dependence of coacervation on temperature and peptide concentration for EP20-24-24

EAK16-II

Molecular structure of EAK16-II peptide

EAK16-II is a self-assembling peptide which forms stable β-sheet structures in water and exists naturally as a region in zuotin, a yeast protein. The amino acid sequence for EAK16-II is AEAEAKAKAEAEAKAK and has an estimated molecular mass of 1615.8. When examined under SEM, a well-ordered nanofibre structure is formed by the association of the EAK16-II proteins and these nanofibres can futher aggregate to form a membranous 3D scaffold.

The alternating positive and negative charges (--++--++) are responsible for creating an electrostatic attraction between adjacent peptides and self-assembly is triggered when the proteins are exposed to physiological media or salt solution.

How B.Subtilis can play a part in material production

Schematic representation of signal peptides for the Sec-SRP pathway in B.subtilis

B.subtilis can act as a cell factory producing and secreting proteins. Proteins can be secreted via three major pathways within the B-subtilis: Secretory signal recognition particle (Sec-SRP) pathway, Twin-arginine translocation (Tat) pathway and the ATP-binding cassette (ABC) transporters. The Sec-SRP pathway would be more suitable in this case because it has been well studied in comparison to the two latter pathways.

The three pathways are differentiated by several factors: the precursor proteins, the structure of the cleavage signal peptides, the secretion machinery components and their special functions.

The precursor protein is an inactive protein or peptide that can be turned into an active form by post-translational modification.


Signal Peptides

Signal peptides are one of the major players in the production process of proteins. They are responsible for directing preproteins, a secretory protein with a signal peptide region attached, into a pathway. Its functions are to stop nascent chains mal-folding, recognising and submitting the peptide chain to the secretory machinery and to act as the topological determinant for preproteins in the membrane.


The Sec-type signal peptides

The Sec-type signal peptides serve to direct pre-proteins from the cytoplasm into the growth medium. Although different signal peptides show little similarity in amino acid sequence, three distinct domains can be distinguished: a positively charged N-terminus (N-region), a central hydrophobic region (H-region) and a polar C-terminal region (C-region). The C-region commonly carries a type-I SPase cleavage site, with the consensus sequence Ala-X-Ala or Val-X-Ala at positions -1 and -3 relative to the cleavage site.

The process of Sec-SRP-dependent proteins secretion

The process can be divided into three steps.

  1. SRP-protein targeting system to cell membrane
  2. Sec protein translocation machinery across the cytoplasmic membrane
  3. Folding and release of protein

At present, about 60% of all commercially available enzymes are produced by Bacillus bacteria due to their huge capacity for secretion. Heterologous proteins that were successfully secreted by Bacillus bacteria include cutinase, α-amylase, proinsulin etc.

We have shortlisted the following three signal peptides to be transcribed upstream of our gene product:


SacB: MNIKKFAKQATVLTFTTALLAGGATQAFAKET

LipA: MKFVKRRIIALVTILMLSVTSLFALQPSAKAAEH

Epr: MKNMSCKLVVSVTLFFSFLTIGPLAHAQNS

References

  1. Bellingham CM, Woodhouse KA, Robson P, Rothstein SJ, and Keeley FW. Self-aggregation characteristics of recombinantly expressed human elastin polypeptides. Biochim Biophys Acta. 2001 Nov 26;1550(1):6-19. DOI:10.1016/s0167-4838(01)00262-x | PubMed ID:11738083 | HubMed [Elastin]
  2. Keeley FW, Bellingham CM, and Woodhouse KA. Elastin as a self-organizing biomaterial: use of recombinantly expressed human elastin polypeptides as a model for investigations of structure and self-assembly of elastin. Philos Trans R Soc Lond B Biol Sci. 2002 Feb 28;357(1418):185-9. DOI:10.1098/rstb.2001.1027 | PubMed ID:11911775 | HubMed [Elastin]
  3. Zhang S, Gelain F, and Zhao X. Designer self-assembling peptide nanofiber scaffolds for 3D tissue cell cultures. Semin Cancer Biol. 2005 Oct;15(5):413-20. DOI:10.1016/j.semcancer.2005.05.007 | PubMed ID:16061392 | HubMed [EAK16-II]
  4. Ling Lin Fu, Zi Rong Xu, Wei Fen Li, Jiang Bing Shuai, Ping Lu, and Chun Xia Hu. Protein secretion pathways in Bacillus subtilis: implication for optimization of heterologous protein secretion. Biotechnol Adv. 2007 Jan-Feb;25(1):1-12. DOI:10.1016/j.biotechadv.2006.08.002 | PubMed ID:16997527 | HubMed [ProteinSecretion]
  5. Tjalsma H, Bolhuis A, Jongbloed JD, Bron S, and van Dijl JM. Signal peptide-dependent protein transport in Bacillus subtilis: a genome-based survey of the secretome. Microbiol Mol Biol Rev. 2000 Sep;64(3):515-47. DOI:10.1128/MMBR.64.3.515-547.2000 | PubMed ID:10974125 | HubMed [Proteomics]

All Medline abstracts: PubMed | HubMed