Antibody:PTBP2 AV40965 Sigma

From OpenWetWare

Jump to: navigation, search
                       
List of OpenWetWare Antibodies
anti PTBP2 AV40965 Sigma
Antibody Type  unknown species polyclonal IgG
Target UniProt ID  Q9UKA9
Cross-Reactive w  human
Not Cross-Reactive w  unknown
Raised Against  peptide
Provider  Sigma
Suitability for..
Western Blot  untested
Immunoprecipitation  untested
Staining fixed cells   untested
Staining cryo-sections  untested
Staining paraffin sections  untested
Help

Description

  • raised against N-terminal peptide of human PTBP2
  • 1 difference to mouse PTBP2 in the same region
human           MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGEDKMDGAPSRV 60
sigma           -DGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGED--------- 50
mouse           MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSGMVVTANGNDSKKFKGEDKMDGAPSRV 60
                 ********************************.*****************         

Warning

  • no species information given on web site
  • WB shown on page shows protein band of the wrong size

Link to manufacturer

(doesn't work in infobox; due to the | character?)

Personal tools