Difference between revisions of "User talk:Etienne Robillard/Notebook/NMDA dependent cell adhesion"

From OpenWetWare
Jump to: navigation, search
(The Nagai (p53) connection: optogenetics tour de force or synthetic red heering ?)
 
 
(No difference)

Latest revision as of 18:40, 14 May 2013

The Nagai (p53) connection: optogenetics tour de force or synthetic red heering ?

  • Protein translation sequence (tblastn):

MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD