Difference between revisions of "User:Etienne Robillard/Notebook/DFP"

From OpenWetWare
Jump to: navigation, search
(Use as metal-bound electrolyte/proton conductor in cyclic imide additions (Maleimide))
(minor modifications)
Line 17: Line 17:
 
* keywords: NADPH+, AuNP, ATP (hydrolysis), cyanophosphine
 
* keywords: NADPH+, AuNP, ATP (hydrolysis), cyanophosphine
  
 +
==Dataset==
 +
 +
===French Press 6.2.1.3 (123aa)===
 +
NKAGARREGSCGKPIGEDYLIEAFDDDGNMLERGGSGELCISSPTVMKGYLNDTEATEKT
 +
FLDYDGKRWLKTGDLGYVDKDGFIFILQRLKRIIKVSGVPVFPAEIERLVNTLKDVDECC
 +
AVGIEHKLKGKVIKLYVKSSAEP
 +
 +
Enzyme name is acyl-coA synthase.
 +
 +
Pathway: http://www.kegg.jp/kegg-bin/show_pathway?T30165_04920+179507
 
== Safety ==
 
== Safety ==
  

Revision as of 06:46, 31 August 2013

Overview

Describe succinic acid here.

Use as voltage-gated pharmacochemical intermediates

  • (2R)-2-(methylamino)succinic acid (also known as N-methyl-D-asparte receptor) - A dicarboxilic acid usable as titrable buffer agent for orthogonal amino acid protection ?

Use as metal-bound electrolyte/proton conductor in cyclic imide additions (Maleimide)

Dataset

French Press 6.2.1.3 (123aa)

NKAGARREGSCGKPIGEDYLIEAFDDDGNMLERGGSGELCISSPTVMKGYLNDTEATEKT FLDYDGKRWLKTGDLGYVDKDGFIFILQRLKRIIKVSGVPVFPAEIERLVNTLKDVDECC AVGIEHKLKGKVIKLYVKSSAEP

Enzyme name is acyl-coA synthase.

Pathway: http://www.kegg.jp/kegg-bin/show_pathway?T30165_04920+179507

Safety

Unknown. The risks and effects of using succinic acid as calcium channel blocker may need further study.

References


Bibliography

  1. Ogawa J, Soong CL, Honda M, and Shimizu S. Imidase, a dihydropyrimidinase-like enzyme involved in the metabolism of cyclic imides. Eur J Biochem. 1997 Jan 15;243(1-2):322-7. PubMed ID:9030755 | HubMed [imidase]

Did you know?

Love isn't something you find. Love is something that finds you.

- Loretta Young