Sap Protein Sequence

From OpenWetWare
Revision as of 19:42, 3 August 2005 by Norville (talk | contribs)
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to: navigation, search

MAKTNSYKKVIAGTMTAAMVAGVVSPVAAAGKTFPDVPADHWGIDSINYLVEKGAVKGNDKGMFEPGKEL TRAEAATMMAQILNLPIDKDAKPSFADSQGQWYTPFIAAVEKAGVIKGTGNGFEPNGKIDRVSMASLLVE AYKLDTKVNGTPATKFKDLETLNWGKEKANILVELGISVGTGDQWEPKKTVTKAEAAQFIAKTDKQFGTE AAKVESAKAVTTQKVEVKFSKAVEKLTKEDIKVTNKANNDKVLVKEVTLSEDKKSATVELYSNLAAKQTY TVDVNKVGKTEVAVGSLEAKTIEMADQTVVADEPTALQFTVKDENGTEVVSPEGIEFVTPAAEKINAKGE ITLAKGTSTTVKAVYKKDGKVVAESKEVKVSAEGAAVASISNWTVAEQNKADFTSKDFKQNNKVYEGDNA YVQVELKDQFNAVTTGKVEYESLNTEVAVVDKATGKVTVLSAGKAPVKVTVKDSKGKELVSKTVEIEAFA QKAMKEIKLEKTNVALSTKDVTDLKVKAPVLDQYGKEFTAPVTVKVLDKDGKELKEQKLEAKYVNKELVL NAAGQEAGNYTVVLTAKSGEKEAKATLALELKAPGAFSKFEVRGLEKELDKYVTEENQKNAMTVSVLPVD ANGLVLKGAEAAELKVTTTNKEGKEVDATDAQVTVQNNSVITVGQGAKAGETYKVTVVLDGKLITTHSFK VVDTAPTAKGLAVEFTSTSLKEVAPNADLKAALLNILSVDGVPATTAKATVSNVEFVSADTNVVAENGTV GAKGATSIYVKNLTVVKDGKEQKVEFDKAVQVAVSIKEAKPATK