Difference between revisions of "IGEM:MIT/2007/Ideas3"

From OpenWetWare
Jump to: navigation, search
(OmpX)
(Sequence)
Line 28: Line 28:
  
 
===Sequence===
 
===Sequence===
#Native SS
+
#Native SS <pre> MKKIACLSALAAVLAFTAGTSVA </pre>
<pre>
+
#Embedded SfiI restriction site <pre> GQSGQ </pre>
MKKIACLSALAAVLAFTAGTSVA
+
#Passenger Peptide <pre> XXXXXXXXXXXXXX </pre>
</pre>
+
#Sequence <pre> GGQSGQ </pre>
#Embedded SfiI restriction site
+
#S54-F148 <pre> SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF </pre>
<pre>
+
#Join native C and N <pre> GGSG </pre>
GQSGQ
+
#A1-S53 <pre> ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS </pre>
</pre>
 
#Passenger Peptide
 
<pre>
 
XXXXXXXXXXXXXX
 
</pre>
 
#Sequence
 
<pre>
 
GGQSGQ
 
</pre>
 
#S54-F148
 
<pre>
 
SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF
 
</pre>
 
Join native C and N
 
GGSG
 
 
 
A1-S53
 
ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS
 
  
 
==Papers!==
 
==Papers!==

Revision as of 12:32, 18 June 2007

Inbox

  • Put Links and Papers you find for another category here
  • Put your initials next to a link if you're in the process of analyzing it

Metal Pumps and Metal Specific Promoters

Mussel Protein

Expressing proteins on E coli cell membranes

Water Purification Methods

Metal Pumps and Metal Specific Promoters

Mussel Protein

Water Purification Methods

OmpX

[J., Welch, R., Erickson, J.W., and Gross, C.A. 1995. Identification and characterization of an outer membrane protein, OmpX, in Escherichia coli that is homologous to a family of outer membrane proteins including Ail of Yersinia enterocolitica. J. Bacteriol. 177: 799–804.Acad. Sci. 98: 3750–3755. Wittrup, K.D. 2001. Protein engineering by cell-surface display. Curr. Opin. Biotechnol. 12: 395–399.]

[|OmpX sequence]

Sequence

  1. Native SS
     MKKIACLSALAAVLAFTAGTSVA 
  2. Embedded SfiI restriction site
     GQSGQ 
  3. Passenger Peptide
     XXXXXXXXXXXXXX 
  4. Sequence
     GGQSGQ  
  5. S54-F148
     SGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF 
  6. Join native C and N
     GGSG 
  7. A1-S53
     ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTAS 

Papers!

  1. Samuelson P, Wernérus H, Svedberg M, and Ståhl S. Staphylococcal surface display of metal-binding polyhistidyl peptides. Appl Environ Microbiol. 2000 Mar;66(3):1243-8. PubMed ID:10698802 | HubMed [Samuelson00]
  2. Kotrba P, Dolecková L, de Lorenzo V, and Ruml T. Enhanced bioaccumulation of heavy metal ions by bacterial cells due to surface display of short metal binding peptides. Appl Environ Microbiol. 1999 Mar;65(3):1092-8. PubMed ID:10049868 | HubMed [Kotrba99]
All Medline abstracts: PubMed | HubMed