Wikiomics:BLAST tutorial (exercises)

From OpenWetWare

Revision as of 11:46, 8 April 2008 by Austin J. Che (Talk | contribs)
(diff) ←Older revision | Current revision (diff) | Newer revision→ (diff)
Jump to: navigation, search
  • blastp with shuffled sequence: note that all hits must be wrong!
>Shuffled_protein
MNALFNGRYVRQNLRFAGFARVDRERPPLTWFQVSAIPLFARGFAGAIDSSRISRSGEAF
VGCVCLAQPCFVGAADGEADLRAGVGSVTVAVNGSLLLFALG
  • what is this nucleotide sequence?
>nucleotide_1
ATATAGTTTTTAATTAGGAGGATTTTATCAATGAAAATATCAATACTATACAGTAGCAAGACAGGAAAAA
CCGAAAGAGTTGCCAAGTTAATTGAAGAAGGTGTGAAGAGGTCTGGAAATATTGAAGTAAAAACTATGAA
TTTAGATGCAGTTGATAAAAAGTTCTTACAAGAATCAGAAGGAATTATTTTTGGAACACCAACTTATTAT
  • same sequence mutated:
>nucleotide_2
ATATAGTATTTAATTAGGAGGATTTCATCAATGACACTCTCAATACTATACAGTAGCAAG
ACAGGGAAAACAGAAAGAGTTGCCAAGGTAATTGAGGAAGGTGTGAAGAGGTCTCAAAAT
AATGAAGTAAGAACTGTGAATCTAGATGCAGTTCATAATAAGTTCTTCGAAGAATCAGGA
GGCATTCTTTTTGGAACACCAACTTATGAT
  • what is it? Any remote similarity?
>protein_1
HIGSDTDGDDDSETEGEWNLKEGGSIDAELSHSRKAKKVESLLRKLHTKDILPEEVSS
GSHLHTRSPMVLFLSLAVPTDKVVMFYKALFTEAELKAPLESLKRFQNNGDARTGKSA
IFMLGGGHFAGAVISHEPVKVKGQLLNEELPYLQKIQSINVLESKTFHRYTTRRKQGG
  • play with your favorite gene/protein
Personal tools