User:Jonathan Cline/Notebook/Melaminometer/Specific Sequences

From OpenWetWare

< User:Jonathan Cline | Notebook | Melaminometer
Revision as of 02:32, 16 October 2008 by Meredith L. Patterson (Talk | contribs)
(diff) ←Older revision | Current revision (diff) | Newer revision→ (diff)
Jump to: navigation, search

Contents

Melamine degradation pathway

Melamine deaminase (Acidovorax avenae subsp. citrulli)

Protein sequence

>gi|11890745|gb|AAG41202.1|AF312304_1 melamine deaminase [Acidovorax avenae subsp. citrulli]
MQTLSIQHGTLVTMDQYRRVLGDSWVHVQDGRIVALGVHAESVPPPADRVIDARGKVVLPGFINAHTHVN
QILLRGGPSHGRQLYDWLFNVLYPGQKAMRPEDVAVAVRLYCAEAVRSGITTINDNADSAIYPGNIEAAM
AVYGEVGVRVVYARMFFDRMDGRIQGYVDALKARSPQVELCSIMEETAVAKDRITALSDQYHGTAGGRIS
VWPAPAITPAVTVEGMRWAQAFARDRAVMWTLHMAESDHDERLHWMSPAEYMECYGLLDERLQVAHCVYF
DRKDVRLLHRHNVKVASQVVSNAYLGSGVAPVPEMVERGMAVGIGTDDGNCNDSVNMIGDMKFMAHIHRA
VHRDADVLTPEKILEMATIDGARSLGMDHEIGSIETGKRADLILLDLRHPQTTPHHHLAATIVFQAYGNE
VDTVLIDGNVVMENRRLSFLPPERELAFLEEAQSRATAILQRANMVANPAWRSL

Nucleotide sequence (1425 bp)

>gi|11890744:1-1425 Pseudomonas sp. NRRL B-12227 melamine deaminase (triA) gene, complete cds
ATGCAAACGCTCAGCATCCAGCACGGTACCCTCGTCACGATGGATCAGTACCGCAGAGTCCTTGGGGATA
GCTGGGTTCACGTGCAGGATGGACGGATCGTCGCGCTCGGAGTGCACGCCGAGTCGGTGCCTCCGCCAGC
GGATCGGGTGATCGATGCACGCGGCAAGGTCGTGTTACCCGGTTTCATCAATGCCCACACCCATGTGAAC
CAGATCCTCCTGCGCGGAGGGCCCTCGCACGGGCGTCAACTCTATGACTGGCTGTTCAACGTTTTGTATC
CGGGACAAAAGGCGATGAGACCGGAGGACGTAGCGGTGGCGGTGAGGTTGTATTGTGCGGAAGCTGTGCG
CAGCGGGATTACGACGATCAACGACAACGCCGATTCGGCCATCTACCCAGGCAACATCGAGGCCGCGATG
GCGGTCTATGGTGAGGTGGGTGTGAGGGTCGTCTACGCCCGCATGTTCTTTGATCGGATGGACGGGCGCA
TTCAAGGGTATGTGGACGCCTTGAAGGCTCGCTCTCCCCAAGTCGAACTGTGCTCGATCATGGAGGAAAC
GGCTGTGGCCAAAGATCGGATCACAGCCCTGTCAGATCAGTATCATGGCACGGCAGGAGGTCGTATATCA
GTTTGGCCCGCTCCTGCCATTACCCCGGCGGTGACAGTTGAAGGAATGCGATGGGCACAAGCCTTCGCCC
GTGATCGGGCGGTAATGTGGACGCTTCACATGGCGGAGAGCGATCATGATGAGCGGCTTCATTGGATGAG
TCCCGCCGAGTACATGGAGTGTTACGGACTCTTGGATGAGCGTCTGCAGGTCGCGCATTGCGTGTACTTT
GACCGGAAGGATGTTCGGCTGCTGCACCGCCACAATGTGAAGGTCGCGTCGCAGGTTGTGAGCAATGCCT
ACCTCGGCTCAGGGGTGGCCCCCGTGCCAGAGATGGTGGAGCGCGGCATGGCCGTGGGCATTGGAACAGA
TGACGGGAATTGTAATGACTCCGTAAACATGATCGGAGACATGAAGTTTATGGCCCATATTCACCGCGCG
GTGCATCGGGATGCGGACGTGCTGACCCCAGAGAAGATTCTTGAAATGGCGACGATCGATGGGGCGCGTT
CGTTGGGAATGGACCACGAGATTGGTTCCATCGAAACCGGCAAGCGCGCGGACCTTATCCTGCTTGACCT
GCGTCACCCTCAGACGACTCCTCACCATCATTTGGCGGCCACGATCGTGTTTCAGGCTTACGGCAATGAG
GTGGACACTGTCCTGATTGACGGAAACGTTGTGATGGAGAACCGCCGCTTGAGCTTTCTTCCCCCTGAAC
GTGAGTTGGCGTTCCTTGAGGAAGCGCAGAGCCGCGCCACAGCTATTTTGCAGCGGGCGAACATGGTGGC
TAACCCAGCTTGGCGCAGCCTCTAG

Ammelide aminohydrolase (Acidovorax avenae subsp. citrulli)

Protein sequence

>gi|12644702|gb|AAK00493.1| ammelide aminohydrolase [Acidovorax avenae subsp. citrulli]
MSMETHSYVDVAIRNARLADTEGIVDILIHDGRIASIVKSTKTKGSVEIDAHEGLVTSGLVEPHIHLDKA
LTADRVPAGSIGDLRTRRGLEMAIRATRDIKRTFTVEDVRERAIRAALMASRAGTTALRTHVDVDPIVGL
AGIRGVLEAREVCAGLIDIQIVAFPQEGLFCSAGAVDLMREAIKLGADAVGGAPALDDRPQDHVRAVFDL
AAEFGLPVDMHVDESDRREDFTLPFVIEAARERRVPNVTVAHISSLSVQTDDVARSTIAALADADVNVVV
NPIIVKITRLSELLDAGVSVMFGSDNLRDPFYPLGAANPLGSAIFACQIAALGTPQDLRRVFDAVTINAA
RMLGFPSLLGVVEGAVADLAVFPSATPEEVVLDQQSPLFVLKGGRVVAMRLAAGSTSFRDYS

Nucleotide sequence (1239 bp)

>gi|12644694:11082-12320 Acidovorax avenae subsp. citrulli s-triazine ring-cleavage gene region 
ATGTCAATGGAAACCCATAGTTATGTAGACGTCGCAATTCGTAACGCGCGTCTTGCCGATACGGAGGGAA 
TTGTCGATATTCTTATTCACGATGGGCGCATTGCGTCCATCGTGAAGTCGACAAAAACAAAAGGATCGGT 
GGAGATCGATGCTCATGAGGGTCTGGTCACTTCCGGCCTGGTAGAGCCTCACATCCATCTCGATAAGGCC 
CTGACGGCAGATCGGGTTCCCGCAGGAAGCATTGGCGACCTTCGAACGCGACGAGGCCTTGAGATGGCAA 
TTCGGGCCACCCGTGATATCAAGCGTACGTTCACGGTTGAAGATGTTCGAGAACGGGCCATACGTGCGGC 
CCTGATGGCATCCCGTGCGGGAACCACCGCATTGCGGACACACGTCGATGTCGACCCGATTGTCGGCCTC 
GCAGGTATCCGTGGTGTCCTTGAGGCGCGTGAAGTCTGCGCGGGATTGATCGATATCCAGATCGTCGCCT 
TCCCTCAGGAGGGACTCTTCTGCTCTGCGGGGGCCGTGGACCTCATGCGGGAGGCGATCAAACTGGGCGC 
GGATGCCGTCGGCGGCGCACCCGCGCTGGATGATCGCCCGCAGGACCATGTCCGAGCCGTTTTTGACCTT 
GCTGCTGAGTTCGGCCTGCCCGTAGACATGCACGTCGATGAGTCCGACCGGCGGGAAGACTTTACGCTTC 
CCTTTGTGATTGAAGCTGCCCGTGAACGGCGTGTGCCCAATGTGACCGTCGCGCACATCAGCTCGCTGTC 
CGTACAGACGGATGACGTAGCACGGTCGACCATTGCCGCCCTTGCGGACGCCGATGTTAATGTCGTGGTT 
AATCCGATCATTGTCAAAATTACGCGGCTGAGTGAATTACTCGATGCCGGAGTCTCCGTAATGTTTGGCT 
CGGACAACCTGCGGGATCCGTTCTATCCGCTCGGAGCGGCGAATCCCCTTGGATCAGCCATTTTTGCCTG 
TCAAATTGCCGCGCTGGGAACACCGCAAGATCTCAGACGGGTATTCGATGCGGTCACCATCAACGCTGCC 
CGCATGCTGGGATTCCCCTCACTTTTAGGCGTCGTGGAAGGGGCAGTCGCGGATCTCGCAGTATTCCCAT 
CGGCGACGCCCGAGGAGGTTGTTCTGGATCAACAGTCTCCGCTCTTCGTACTCAAGGGCGGACGTGTCGT 
TGCCATGCGATTGGCCGCTGGATCAACGTCGTTCCGCGACTACTCATGA

Cyanurate degradation pathway

Cyanuric acid amidohydrolase (Acidovorax avenae subsp. citrulli)

Protein sequence

>gi|3659839|gb|AAC61577.1| cyanuric acid amidohydrolase [Acidovorax avenae subsp. citrulli]
MQAQVFRVPMSNPADVSGVAKLIDEGVIRAEEVVCVLGKTEGNGCVNDFTRGYTTLAFKVYFSEKLGVSR
QEVGERIAFIMSGGTEGVMAPHCTIFTVQKTDNKQKTAAEGKRLAVQQIFTREFLPEEIGRMPQVTETAD
AVRRAMREAGIADASDVHFVQVKCPLLTAGRMHDAVERGHTVATEDTYESMGYSRGASALGIALALGEVE
KANLSDEVITADYSLYSSVASTSAGIELMNNEIIVMGNSRAWGGDLVIGHAEMKDAIDGAAVRQALRDVG
CCENDLPTVDELGRVVNVFAKAEASPDGEVRNRRHTMLDDSDINSTRHARAVVNAVIASIVGDPMVYVSG
GSEHQGPAGGGPVAVIARTA

Nucleotide sequence (1113 bp)

>gi|12644694:8966-10078 Acidovorax avenae subsp. citrulli s-triazine ring-cleavage gene region 
ATGCAAGCGCAAGTTTTTCGAGTTCCAATGAGTAATCCAGCCGATGTTAGTGGCGTAGCCAAGCTCATCG 
ATGAGGGAGTGATCCGTGCCGAAGAGGTCGTCTGCGTTCTCGGCAAGACCGAAGGCAACGGCTGTGTCAA 
TGACTTCACGCGTGGCTACACCACCCTCGCGTTCAAGGTCTACTTCTCCGAGAAACTGGGCGTGTCCCGG 
CAAGAGGTCGGCGAGCGCATCGCTTTCATCATGTCCGGCGGTACCGAAGGCGTCATGGCGCCTCACTGCA 
CCATCTTCACCGTGCAGAAGACGGACAACAAGCAGAAGACCGCCGCTGAAGGCAAGCGACTTGCCGTTCA 
GCAGATCTTTACCCGCGAGTTCCTGCCGGAGGAGATCGGCCGCATGCCGCAGGTCACGGAAACAGCCGAC 
GCTGTTCGCCGCGCCATGCGCGAAGCCGGCATCGCGGATGCATCCGATGTCCACTTCGTTCAGGTCAAGT 
GCCCACTGCTCACTGCCGGCCGCATGCATGACGCTGTCGAGCGCGGGCATACGGTTGCCACCGAAGATAC 
CTATGAGTCCATGGGCTACTCCCGCGGCGCATCCGCGCTTGGTATCGCCCTGGCCCTCGGGGAAGTCGAG 
AAGGCCAACCTCAGTGATGAAGTTATTACCGCAGACTACAGTCTCTACTCCTCGGTTGCCTCAACTTCGG 
CGGGTATCGAGTTGATGAACAACGAGATCATCGTCATGGGCAACAGCCGCGCATGGGGTGGTGACCTCGT 
CATCGGCCACGCCGAGATGAAGGACGCCATCGACGGTGCAGCGGTCCGGCAGGCCCTGCGCGACGTCGGG 
TGCTGCGAGAACGACCTGCCGACCGTCGACGAGCTCGGCCGCGTGGTCAATGTATTTGCCAAGGCTGAAG 
CCTCCCCGGACGGTGAGGTTCGTAACCGCCGCCACACGATGCTGGACGATTCGGACATTAACAGCACGCG 
CCATGCGCGAGCGGTCGTCAATGCAGTTATCGCTTCGATCGTGGGAGATCCCATGGTTTATGTCTCCGGC 
GGCTCCGAGCATCAGGGCCCCGCCGGTGGCGGTCCCGTTGCAGTTATCGCGCGCACAGCTTAA

Biuret hydrolase (Pseudomonas sp. ADP)

Protein sequence

>gi|13937521|gb|AAK50332.1|U66917_101 biuret hydrolase [Pseudomonas sp. ADP] 
MKTVEIIEGIASGRTSARDVCEEALATIGATDGLINAFTCRTVERARAEADAIDVRRARGEVLPPLAGLP 
YAVKNLFDIEGVTTLAGSKINRTLPPARADAVLVQRLKAAGAVLLGGLNMDEFAYGFTTENTHYGPTRNP 
HDTGRIAGGSSGGSGAAIAAGQVPLSLGSDTNGSIRVPASLCGVWGLKPTFGRLSRRGTYPFVHSIDHLG 
PLADSVEGLALAYDAMQGPDPLDPGCSASRIQPSVPVLSQGIAGLRIGVLGGWFRDNAGPAARAAVDVAA 
LTLGASEVVMWPDAEIGRAAAFVITASEGGCLHLDDLRIRPQDFEPLSVDRFISGVLQPVAWYLRAQRFR 
RVYRDKVNALFRDWDILIAPATPISAPAIGTEWIEVNGTRHPCRPAMGLLTQPVSFAGCPVVAAPTWPGE 
NDGMPIGVQLIAAPWNESLCLRAGKVLQDTGIARLKC

Nucleotide sequence (1374 bp)

>gi|13937422:102427-103800 Pseudomonas sp. ADP atrazine catabolic plasmid pADP-1, complete sequence 
ATGAAGACAGTAGAAATTATTGAAGGTATCGCCTCTGGCAGAACCAGTGCGCGCGACGTGTGCGAAGAGG 
CGCTCGCAACCATCGGCGCGACCGATGGACTCATCAATGCCTTTACATGCCGTACGGTTGAACGAGCCCG 
CGCAGAGGCGGATGCCATCGATGTTCGACGGGCGCGCGGCGAGGTACTTCCGCCTCTTGCCGGCCTCCCC 
TACGCGGTAAAGAATCTGTTCGACATCGAAGGCGTGACGACGCTTGCCGGCTCGAAGATCAACCGTACTC 
TCCCGCCTGCGCGCGCAGACGCCGTGCTGGTGCAACGGCTGAAAGCTGCCGGCGCCGTGCTCCTGGGCGG 
CCTCAATATGGACGAGTTTGCCTATGGATTTACGACCGAAAATACGCACTATGGGCCGACCCGGAACCCG 
CATGACACCGGGCGTATCGCTGGTGGTTCGTCAGGGGGGTCTGGAGCGGCAATCGCTGCGGGGCAGGTAC 
CACTATCGCTCGGATCGGACACCAACGGTTCCATACGCGTGCCAGCATCATTGTGTGGCGTGTGGGGGCT 
GAAGCCTACCTTCGGCCGCCTGTCCCGGCGAGGGACATACCCGTTTGTTCACAGCATTGATCACCTCGGG 
CCATTGGCCGATAGCGTGGAAGGCTTGGCGTTGGCCTACGATGCAATGCAGGGCCCGGATCCGCTCGACC 
CCGGATGCAGCGCATCGCGCATCCAACCCTCGGTACCGGTCCTCAGTCAGGGTATCGCTGGGCTCCGGAT 
CGGCGTGCTGGGTGGCTGGTTTCGGGACAATGCCGGCCCGGCCGCGCGAGCCGCGGTCGATGTTGCCGCG 
CTTACGCTCGGCGCCAGCGAAGTCGTCATGTGGCCCGACGCGGAGATCGGGCGCGCAGCCGCCTTCGTTA 
TCACTGCCAGCGAGGGAGGCTGTCTGCATCTCGATGATCTTCGCATCCGTCCGCAAGACTTCGAGCCTCT 
GTCCGTAGATCGCTTTATCTCGGGGGTTTTACAACCGGTCGCGTGGTACTTGCGTGCACAGCGGTTTCGA 
CGTGTCTATCGAGATAAGGTGAATGCTCTTTTCCGTGACTGGGACATATTAATCGCTCCCGCAACGCCAA 
TAAGTGCTCCCGCAATCGGCACCGAATGGATCGAGGTAAACGGTACACGCCATCCGTGCCGCCCGGCTAT 
GGGACTTCTCACTCAGCCGGTCTCCTTCGCAGGCTGTCCGGTGGTCGCCGCTCCAACGTGGCCTGGAGAA 
AACGATGGCATGCCGATCGGGGTACAGCTCATCGCGGCGCCCTGGAACGAATCTCTATGCCTGCGCGCAG 
GCAAGGTATTACAAGACACCGGTATCGCCCGACTGAAATGTTAA

Allophanate hydrolase (Pseudomonas sp. ADP)

Protein sequence

>gi|13937522|gb|AAK50333.1|U66917_102 allophanate hydrolase [Pseudomonas sp. ADP] 
MNDRAPHPERSGRVTPDHLTDLASYQAAYAAGTDAADVISDLYARIKEDGENPIWISLLPLESALAMLAD 
AQQRKDKGEALPLFGIPFGVKDNIDVAGLPTTAGCTGFARTPRQHAFVVQRLVDAGAIPIGKTNLDQFAT 
GLNGTRTPFGIPRCVFNENYVSGGSSSGSAVAVANGTVPFSLGTDTAGSGRIPAAFNNLVGLKPTKGLFS 
GSGLVPAARSLDCISVLAHTVDDALAVARVAAGYDADDAFSRKAGAAALTEKSWPRRFNFGVPAAEHRQF 
FGDAEAEALFNKAVRKLEEMGGTCISFDYTPFRQAAELLYAGPWVAERLAAIESLADEHPEVLHPVVRDI 
ILSAKRMSAVDTFNGIYRLADLVRAAESTWEKIDVMLLPTAPTIYTVEDMLADPVRLNSNLGFYTNFVNL 
MDLSAIAVPAGFRTNGLPFGVTFIGRAFEDGAIASLGKAFVEHDLAKGNAATAAPPKDTVAIAVVGAHLS 
DQPLNHQLTESGGKLRATTRTAPGYALYALRDATPAKPGMLRDQNAVGSIEVEIWDLPVAGFGAFVSEIP 
APLGIGTITLEDGSHVKGFLCEPHAIETALDITHYGGWRAYLAAQ

Nucleotide sequence (1818 bp)

>gi|13937422:104283-106100 Pseudomonas sp. ADP atrazine catabolic plasmid pADP-1, complete sequence 
ATGAATGACCGCGCGCCCCACCCTGAAAGATCTGGTCGAGTCACGCCGGATCACCTGACCGATCTGGCTT 
CCTATCAGGCTGCCTATGCCGCCGGTACAGACGCCGCCGACGTCATTTCGGACCTGTATGCCCGTATCAA 
AGAAGACGGCGAAAATCCGATCTGGATTAGCCTGTTGCCCTTGGAAAGCGCATTGGCGATGCTGGCCGAC 
GCGCAGCAACGCAAGGACAAGGGAGAAGCGTTGCCGCTCTTTGGCATCCCCTTCGGCGTCAAGGACAACA 
TCGACGTCGCAGGCCTTCCGACGACTGCCGGGTGTACGGGGTTCGCGCGTACGCCCCGACAGCACGCCTT 
CGTCGTACAGCGCCTGGTGGACGCTGGCGCGATCCCGATCGGAAAAACGAACCTCGATCAATTCGCGACC 
GGGTTGAACGGCACTCGCACGCCGTTTGGCATTCCGCGCTGCGTGTTCAACGAGAACTACGTATCCGGCG 
GCTCCAGCAGTGGCTCCGCAGTGGCCGTCGCCAACGGCACGGTACCGTTCTCGCTCGGGACGGACACTGC 
CGGTTCCGGCCGCATTCCTGCTGCGTTCAACAATCTGGTGGGCTTGAAACCGACCAAAGGCCTGTTCTCG 
GGCAGTGGACTGGTTCCCGCGGCGCGAAGCCTTGACTGCATCAGCGTCCTCGCCCATACCGTAGATGACG 
CCCTTGCGGTCGCACGCGTCGCCGCCGGCTACGATGCTGATGACGCTTTTTCGCGCAAGGCGGGCGCCGC 
CGCACTGACAGAAAAGAGTTGGCCTCGTCGCTTCAATTTCGGGGTCCCAGCGGCGGAACATCGCCAGTTT 
TTCGGTGACGCGGAAGCCGAGGCGCTTTTCAATAAAGCGGTTCGCAAGCTTGAAGAGATGGGTGGCACCT 
GCATCTCGTTTGACTATACCCCCTTCAGGCAGGCTGCTGAACTGCTCTACGCCGGCCCTTGGGTTGCGGA 
GCGCCTGGCGGCCATCGAGAGCCTTGCGGACGAGCATCCCGAGGTGCTCCACCCGGTCGTTCGTGACATC 
ATCTTGTCCGCGAAGCGAATGAGCGCAGTCGACACGTTCAACGGTATCTATCGCCTGGCCGACCTTGTCA 
GGGCTGCAGAGAGCACTTGGGAAAAGATCGATGTGATGCTGCTGCCGACGGCGCCGACCATCTACACTGT 
AGAAGACATGCTCGCCGATCCGGTACGCCTCAACAGCAATCTGGGCTTCTACACGAACTTCGTGAACTTG 
ATGGATTTGTCCGCGATTGCTGTTCCCGCAGGCTTCCGAACCAATGGCCTGCCATTTGGCGTCACTTTCA 
TCGGTCGGGCGTTCGAAGATGGGGCGATCGCAAGCTTGGGAAAAGCTTTCGTGGAGCACGACCTCGCCAA 
GGGCAACGCGGCCACGGCGGCGCCACCCAAGGATACCGTCGCAATCGCCGTGGTAGGTGCACATCTCTCC 
GACCAGCCCTTGAATCATCAGCTCACGGAGAGCGGCGGAAAGCTACGGGCAACAACGCGTACTGCGCCGG 
GATATGCCTTGTACGCACTCCGTGATGCGACGCCGGCTAAGCCTGGAATGTTGCGCGACCAGAATGCGGT 
CGGGAGCATCGAAGTGGAAATCTGGGATCTGCCGGTCGCCGGGTTCGGTGCGTTTGTAAGTGAAATTCCG 
GCGCCGTTGGGTATCGGGACAATAACACTCGAAGACGGCAGCCATGTGAAAGGCTTTCTGTGCGAGCCAC 
ATGCCATCGAGACGGCGCTCGACATCACTCACTACGGCGGCTGGCGAGCATACCTCGCGGCTCAATAG
Personal tools