User:Etienne Robillard/Notebook/OPH

From OpenWetWare

(Difference between revisions)
Jump to: navigation, search
(OPH/DFP)

Revision as of 19:29, 2 September 2013

Contents


Overview

Describe succinic acid here.

Use as voltage-gated pharmacochemical intermediates

  • (2R)-2-(methylamino)succinic acid (also known as N-methyl-D-asparte receptor) - A dicarboxilic acid usable as titrable buffer agent for orthogonal amino acid protection ?

Use as metal-bound electrolyte/proton conductor in cyclic imide additions (Maleimide)

Dataset

French Press 6.2.1.3 (123aa)

NKAGARREGSCGKPIGEDYLIEAFDDDGNMLERGGSGELCISSPTVMKGYLNDTEATEKT FLDYDGKRWLKTGDLGYVDKDGFIFILQRLKRIIKVSGVPVFPAEIERLVNTLKDVDECC AVGIEHKLKGKVIKLYVKSSAEP

Enzyme name is acyl-coA synthase.

Pathway: http://www.kegg.jp/kegg-bin/show_pathway?T30165_04920+179507

Matrix

OPH/DFP

doi: 10.1016/j.abb.2005.08.012

DOI: 10.1002/0471264180.or025.02

Safety

Unknown. The risks and effects of using succinic acid as calcium channel blocker may need further study.

References

  1. http://www.ccrc.uga.edu/~rcarlson/bcmb3100/Chap27.pdf
  2. http://www.ebi.ac.uk/interpro/entry/IPR000980

Bibliography

  1. Ogawa J, Soong CL, Honda M, and Shimizu S. . pmid:9030755. PubMed HubMed [imidase]

Did you know?

Love isn't something you find. Love is something that finds you. - Loretta Young
Personal tools