User:Etienne Robillard/Notebook/DFP

From OpenWetWare

< User:Etienne Robillard | Notebook(Difference between revisions)
Jump to: navigation, search
m (OPH/DFP)
Current revision (21:31, 20 July 2015) (view source)
(Replacing page with '{{deleteme}}')
 
(23 intermediate revisions not shown.)
Line 1: Line 1:
-
__TOC__
+
{{deleteme}}
-
 
+
-
== Overview ==
+
-
 
+
-
Notes about OPH (Organo-Phosphate Hydrolase), an enzyme
+
-
found in H. sapiens.
+
-
 
+
-
==Use as voltage-gated, metal-bound electrolyte/proton conductor in cyclic imide additions (Maleimide) ==
+
-
+
-
* cyclic imide hydrolase (Maleimide) : http://www.kegg.jp/dbget-bin/www_bget?ec:3.5.2.16
+
-
* pathway (nicotinamide metabolism): http://www.kegg.jp/kegg-bin/show_pathway?map00760+C01596
+
-
* ATP-dependent hydrolase ?
+
-
* nicotinamide (NAD-specific) '''neurotoxic''' agent ? 
+
-
* keywords: NADPH+, AuNP, ATP (hydrolysis), cyanophosphine
+
-
 
+
-
==Dataset==
+
-
 
+
-
===French Press 6.2.1.3 (123aa)===
+
-
NKAGARREGSCGKPIGEDYLIEAFDDDGNMLERGGSGELCISSPTVMKGYLNDTEATEKT
+
-
FLDYDGKRWLKTGDLGYVDKDGFIFILQRLKRIIKVSGVPVFPAEIERLVNTLKDVDECC
+
-
AVGIEHKLKGKVIKLYVKSSAEP
+
-
 
+
-
Enzyme name is acyl-coA synthase.
+
-
 
+
-
Pathway: http://www.kegg.jp/kegg-bin/show_pathway?T30165_04920+179507
+
-
 
+
-
[http://prosite.expasy.org/PS50001 Matrix]
+
-
 
+
-
===OPH/DFP===
+
-
 
+
-
doi: 10.1016/j.abb.2005.08.012, 10.1002/0471264180.or025.02
+
-
 
+
-
oph: A organo-phosphate (P-O) hydroxyl bound to a ketone or aldehyde. Synthetic intermediate and precursor to organo-phosphate agents known as [http://www.uniprot.org/uniprot/P22303 AChE] inhibitors. Reaction is catalyzed by the Organo-Phosphate Hydrolase enzyme, thus a (Mg)ATP-dependent ligase. See related DOIs above.
+
-
 
+
-
dfp (Isoflurophate): http://www.drugbank.ca/drugs/DB00677, [http://en.wikipedia.org/wiki/Isoflurophate Wikipedia]
+
-
 
+
-
EC 3.1.8.2  (DFPase) http://www.genome.jp/dbget-bin/www_bget?ec:3.1.8.2
+
-
 
+
-
EC 3.1.8.1 (Parathion hydrolase) http://www.uniprot.org/uniprot/P0A433, http://www.drugbank.ca/drugs/DB02138
+
-
 
+
-
[http://www.hmdb.ca/metabolites/HMDB13035 HMDB]
+
-
 
+
-
keywords: functionalized diphosphine, chim trills, DFP, Paraoxon
+
-
 
+
-
Reaction type: <font color=blue>oxidative desulfuration</font color> ([http://biocyc.org/META/NEW-IMAGE?type=COMPOUND&object=PARAOXON BioCyc])
+
-
 
+
-
Related: [http://www.uniprot.org/uniprot/O15530 3-phosphoinositide-dependent protein kinase 1], [http://www.uniprot.org/uniprot/Q00005 Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform]
+
-
 
+
-
[http://www.jbc.org/content/283/3/1480.full Regulation of 3-Phosphoinositide-dependent Protein Kinase-1 (PDK1) by Src Involves Tyrosine Phosphorylation of PDK1 and Src Homology 2 Domain Binding]
+
-
 
+
-
=== BBC x GFP ===
+
-
 
+
-
* A sort of patented EGFP (chromophore) used as organo-phosphate dye (read dimer?).
+
-
* Used for detection of Sarin (GB) gas et al.
+
-
* Notes:
+
-
# What is a chromophore?
+
-
# More info on '''EGFP''' may be found [[GFP|here]].
+
-
# US Patent:
+
-
 
+
-
== Safety ==
+
-
 
+
-
Unknown. The risks and effects of using succinic acid as calcium channel blocker may need further
+
-
study.
+
-
 
+
-
==References==
+
-
 
+
-
# http://www.ccrc.uga.edu/~rcarlson/bcmb3100/Chap27.pdf
+
-
# http://www.ebi.ac.uk/interpro/entry/IPR000980
+
-
# [http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3076885/ Turning a protein kinase on or off from a single allosteric site via disulfide trapping]
+
-
 
+
-
==Bibliography==
+
-
<biblio>
+
-
#imidase pmid=9030755
+
-
</biblio>
+
-
 
+
-
==Did you know?==
+
-
 
+
-
 
+
-
<blockquote>
+
-
Love isn't something you find. Love is something that finds you.
+
-
 
+
-
- Loretta Young
+
-
</blockquote>
+
-
 
+
-
 
+
-
[[Category:Material]]
+
-
[[Category:Buffers]]
+

Current revision

It has been requested that this page be removed with restriction endonucleases.
Other articles for deletion are listed here.
Personal tools