User:Etienne Robillard/Notebook/DFP

From OpenWetWare

< User:Etienne Robillard | Notebook(Difference between revisions)
Jump to: navigation, search
m (OPH/DFP)
Current revision (09:10, 18 June 2015) (view source)
(Experimental)
 
(22 intermediate revisions not shown.)
Line 1: Line 1:
__TOC__
__TOC__
-
== Overview ==
 
-
Notes about OPH (Organo-Phosphate Hydrolase), an enzyme
 
-
found in H. sapiens.
 
-
 
-
==Use as voltage-gated, metal-bound electrolyte/proton conductor in cyclic imide additions (Maleimide) ==
 
-
 
-
* cyclic imide hydrolase (Maleimide) : http://www.kegg.jp/dbget-bin/www_bget?ec:3.5.2.16
 
-
* pathway (nicotinamide metabolism): http://www.kegg.jp/kegg-bin/show_pathway?map00760+C01596
 
-
* ATP-dependent hydrolase ?
 
-
* nicotinamide (NAD-specific) '''neurotoxic''' agent ? 
 
-
* keywords: NADPH+, AuNP, ATP (hydrolysis), cyanophosphine
 
==Dataset==
==Dataset==
-
 
+
===DFP===
-
===French Press 6.2.1.3 (123aa)===
+
-
NKAGARREGSCGKPIGEDYLIEAFDDDGNMLERGGSGELCISSPTVMKGYLNDTEATEKT
+
-
FLDYDGKRWLKTGDLGYVDKDGFIFILQRLKRIIKVSGVPVFPAEIERLVNTLKDVDECC
+
-
AVGIEHKLKGKVIKLYVKSSAEP
+
-
 
+
-
Enzyme name is acyl-coA synthase.
+
-
 
+
-
Pathway: http://www.kegg.jp/kegg-bin/show_pathway?T30165_04920+179507
+
-
 
+
-
[http://prosite.expasy.org/PS50001 Matrix]
+
-
 
+
-
===OPH/DFP===
+
doi: 10.1016/j.abb.2005.08.012, 10.1002/0471264180.or025.02
doi: 10.1016/j.abb.2005.08.012, 10.1002/0471264180.or025.02
-
oph: A organo-phosphate (P-O) hydroxyl bound to a ketone or aldehyde. Synthetic intermediate and precursor to organo-phosphate agents known as [http://www.uniprot.org/uniprot/P22303 AChE] inhibitors. Reaction is catalyzed by the Organo-Phosphate Hydrolase enzyme, thus a (Mg)ATP-dependent ligase. See related DOIs above.
+
dfp (Isoflurophate): http://www.drugbank.ca/drugs/DB00677
-
 
+
-
dfp (Isoflurophate): http://www.drugbank.ca/drugs/DB00677, [http://en.wikipedia.org/wiki/Isoflurophate Wikipedia]
+
EC 3.1.8.2  (DFPase) http://www.genome.jp/dbget-bin/www_bget?ec:3.1.8.2
EC 3.1.8.2  (DFPase) http://www.genome.jp/dbget-bin/www_bget?ec:3.1.8.2
Line 41: Line 16:
[http://www.hmdb.ca/metabolites/HMDB13035 HMDB]  
[http://www.hmdb.ca/metabolites/HMDB13035 HMDB]  
-
keywords: functionalized diphosphine, chim trills, DFP, Paraoxon
 
-
Reaction type: <font color=blue>oxidative desulfuration</font color> ([http://biocyc.org/META/NEW-IMAGE?type=COMPOUND&object=PARAOXON BioCyc])
 
-
Related: [http://www.uniprot.org/uniprot/O15530 3-phosphoinositide-dependent protein kinase 1], [http://www.uniprot.org/uniprot/Q00005 Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform]
+
Sarin derivative?
-
[http://www.jbc.org/content/283/3/1480.full Regulation of 3-Phosphoinositide-dependent Protein Kinase-1 (PDK1) by Src Involves Tyrosine Phosphorylation of PDK1 and Src Homology 2 Domain Binding]
+
===Experimental===
 +
* DFP-induced '''autonomic hyporeactivity''': Chronic, low-level exposure to anticholinesterases may alter the [http://en.wikipedia.org/wiki/Autonomic_nervous_system#Sympathetic_nervous_system sympathic nervous system] (hypothalamus) and promote depression.
-
=== BBC x GFP ===
+
==Safety==
-
* A sort of patented EGFP (chromophore) used as organo-phosphate dye (read dimer?).
+
DFP is a neurotoxicant. The effects of chronic low-level exposure to DFP require
-
* Used for detection of Sarin (GB) gas et al.
+
further study.
-
* Notes:
+
-
# What is a chromophore?
+
-
# More info on '''EGFP''' may be found [[GFP|here]].
+
-
# US Patent:
+
-
== Safety ==
+
==Keywords==
-
 
+
organophosphate, DFP, Paraoxon, dopamine signaling, neurotoxicant, neuropathy
-
Unknown. The risks and effects of using succinic acid as calcium channel blocker may need further
+
-
study.
+
==References==
==References==
-
 
+
# http://www.drugsandpoisons.com/2008/08/diisopropyl-fluorophosphate-dfp-sarins.html
-
# http://www.ccrc.uga.edu/~rcarlson/bcmb3100/Chap27.pdf
+
# [https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3188672/ Organophosphates dysregulate dopamine signaling, glutamatergic neurotransmission, and induce neuronal injury markers in striatum]
-
# http://www.ebi.ac.uk/interpro/entry/IPR000980
+
# [https://www.ncbi.nlm.nih.gov/pmc/articles/PMC498598/ THE EFFECTS OF DIISOPROPYLFLUOROPHOSPHONATE IN SCHIZOPHRENIA AND MANIC DEPRESSIVE PSYCHOSIS]
-
# [http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3076885/ Turning a protein kinase on or off from a single allosteric site via disulfide trapping]
+
-
 
+
-
==Bibliography==
+
-
<biblio>
+
-
#imidase pmid=9030755
+
-
</biblio>
+
==Did you know?==
==Did you know?==
-
 
-
 
<blockquote>
<blockquote>
Love isn't something you find. Love is something that finds you.
Love isn't something you find. Love is something that finds you.
Line 82: Line 42:
- Loretta Young
- Loretta Young
</blockquote>
</blockquote>
-
 
-
 
-
[[Category:Material]]
 
-
[[Category:Buffers]]
 

Current revision

Contents



Dataset

DFP

doi: 10.1016/j.abb.2005.08.012, 10.1002/0471264180.or025.02

dfp (Isoflurophate): http://www.drugbank.ca/drugs/DB00677

EC 3.1.8.2 (DFPase) http://www.genome.jp/dbget-bin/www_bget?ec:3.1.8.2

EC 3.1.8.1 (Parathion hydrolase) http://www.uniprot.org/uniprot/P0A433, http://www.drugbank.ca/drugs/DB02138

HMDB


Sarin derivative?

Experimental

  • DFP-induced autonomic hyporeactivity: Chronic, low-level exposure to anticholinesterases may alter the sympathic nervous system (hypothalamus) and promote depression.

Safety

DFP is a neurotoxicant. The effects of chronic low-level exposure to DFP require further study.

Keywords

organophosphate, DFP, Paraoxon, dopamine signaling, neurotoxicant, neuropathy

References

  1. http://www.drugsandpoisons.com/2008/08/diisopropyl-fluorophosphate-dfp-sarins.html
  2. Organophosphates dysregulate dopamine signaling, glutamatergic neurotransmission, and induce neuronal injury markers in striatum
  3. THE EFFECTS OF DIISOPROPYLFLUOROPHOSPHONATE IN SCHIZOPHRENIA AND MANIC DEPRESSIVE PSYCHOSIS

Did you know?

Love isn't something you find. Love is something that finds you. - Loretta Young
Personal tools