SBB11Ntbk-ChrisAnderson: Difference between revisions

From OpenWetWare
Jump to navigationJump to search
No edit summary
 
(4 intermediate revisions by the same user not shown)
Line 1: Line 1:
[[Template:SBB11_StressPromoter | Stress Promoter Features]]<br>
__NOTOC__
[[Template:SBB11_ToxicProtein | Toxic Protein Features]]<br>
==~~!~~==
==[[User:JCAnderson|JCAnderson]] 13:03, 3 February 2011 (EST)==
This is my next entry.


[[Template:SBB10Indiv-11097 | Joanna Chen]]<br>
==[[User:JCAnderson|JCAnderson]] 22:54, 31 January 2011 (EST)==
[[Template:SBB10_ProjectGeneralNotes]]
Sequencing data for the first two clones of both sbb17 and sbb18 came in last week.  I analyzed the data and found 2 non-silent point mutations in sbb17 clone 1 and a deletion in sbb17 clone 2, so I needed additional clones of sbb17 sequenced.  Both clone 1 and clone 2 of sbb18 were perfect.   
==Overview==
 
Your two parts are very similar and they require gene synthesis.  In designing your oligos, you should codon optimize the gene sequence for ''E. coli'' and try to maximize re-use of your oligos in making this.  You might need to write a small program to help you generate this, and JCA can provide you some starter files to help you out.
Today, additional sequencing data for sbb17 came in. Both clones 3 and 4 were perfect.
==sbb17: Zinc Finger Domain (zf+)==
  Source:  Synthetic
  Target Sequence:    MAPKKKRKVGIHGVPAAMAERPFQCRICMRNFSRSDTLSEHIRTHTGEKPFACDICGRKFAARSTRTTHTKIHTGSQKPFQCRICMRNFSRSDSLSKHIRTHTGEKPFACDICGRKFAQRSNLKVHTKIHLR  
  Vector:  pBjk2741
  Short desciprion:  {<zf+>}
  Flavor:  {<part>}
  Family:  Zinc Finger
{{SBB10_DBDdomain}}
{{SBB10_ZFN}}
{{SBB10_ZFT}}

Latest revision as of 11:03, 3 February 2011

~~!~~

JCAnderson 13:03, 3 February 2011 (EST)

This is my next entry.

JCAnderson 22:54, 31 January 2011 (EST)

Sequencing data for the first two clones of both sbb17 and sbb18 came in last week. I analyzed the data and found 2 non-silent point mutations in sbb17 clone 1 and a deletion in sbb17 clone 2, so I needed additional clones of sbb17 sequenced. Both clone 1 and clone 2 of sbb18 were perfect.

Today, additional sequencing data for sbb17 came in. Both clones 3 and 4 were perfect.

Retrieved from "https://openwetware.org/mediawiki/index.php?title=SBB11Ntbk-ChrisAnderson&oldid=490739"